PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_008232412.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family M-type_MADS
Protein Properties Length: 234aa    MW: 26046.2 Da    PI: 8.9632
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_008232412.1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF74.67.6e-242168249
                    ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEE CS
          SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyey 49
                    + en  n+qvtfskRr gi+KKA ELSvLC+aev vi+fs+ gk++ y
  XP_008232412.1 21 KLENLNNKQVTFSKRRSGIFKKAAELSVLCGAEVGVIVFSTAGKVFCY 68
                    67999***************************************9877 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006627.4321272IPR002100Transcription factor, MADS-box
SMARTSM004324.6E-331271IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.44E-271383IPR002100Transcription factor, MADS-box
CDDcd002653.03E-341388No hitNo description
PROSITE patternPS0035001468IPR002100Transcription factor, MADS-box
PRINTSPR004041.1E-221434IPR002100Transcription factor, MADS-box
PfamPF003194.0E-222268IPR002100Transcription factor, MADS-box
PRINTSPR004041.1E-223449IPR002100Transcription factor, MADS-box
PRINTSPR004041.1E-224970IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 234 aa     Download sequence    Send to blast
MVILRKLPKR TQGRKRIEIK KLENLNNKQV TFSKRRSGIF KKAAELSVLC GAEVGVIVFS  60
TAGKVFCYGH PNVETVLECY RSGVAPSAVS DDTAGDQNPN RVPMAEFNKE YMEAIKELEE  120
QKRRVVEVKE AVRMKKMVMG VVGGCGERFW WEDESVDLDV LDVQEVEHYL MSLEDVRKKV  180
AARLHEVRIL NGTLAPGALP PVPAVHRLCH MPMMTNGFGA QGGQFGGGYH GFGV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_P6e-161393282Myocyte-specific enhancer factor 2B
1tqe_Q6e-161393282Myocyte-specific enhancer factor 2B
1tqe_R6e-161393282Myocyte-specific enhancer factor 2B
1tqe_S6e-161393282Myocyte-specific enhancer factor 2B
6byy_A7e-161393282MEF2 CHIMERA
6byy_B7e-161393282MEF2 CHIMERA
6byy_C7e-161393282MEF2 CHIMERA
6byy_D7e-161393282MEF2 CHIMERA
6bz1_A8e-161393282MEF2 CHIMERA
6bz1_B8e-161393282MEF2 CHIMERA
6bz1_C8e-161393282MEF2 CHIMERA
6bz1_D8e-161393282MEF2 CHIMERA
6c9l_A6e-161393282Myocyte-specific enhancer factor 2B
6c9l_B6e-161393282Myocyte-specific enhancer factor 2B
6c9l_C6e-161393282Myocyte-specific enhancer factor 2B
6c9l_D6e-161393282Myocyte-specific enhancer factor 2B
6c9l_E6e-161393282Myocyte-specific enhancer factor 2B
6c9l_F6e-161393282Myocyte-specific enhancer factor 2B
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_008232412.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008232412.11e-174PREDICTED: agamous-like MADS-box protein AGL29
TrEMBLM5X4K91e-146M5X4K9_PRUPE; Uncharacterized protein
STRINGXP_008232412.11e-173(Prunus mume)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF12833331
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G65360.12e-25AGAMOUS-like 23