PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_008232276.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family M-type_MADS
Protein Properties Length: 363aa    MW: 41977.4 Da    PI: 7.0618
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_008232276.2genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF602.8e-191151343
                    --SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TT CS
          SRF-TF  3 ienksnrqvtfskRrngilKKAeELSvLCdaevaviifsst 43
                    i n++ r++tf kR +g++KKA+E S+LC+++v++ii++++
  XP_008232276.2 11 IANERSRKTTFQKRSKGMMKKAYEFSTLCEVDVCIIIYGPK 51
                    89*************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004325.2E-19158IPR002100Transcription factor, MADS-box
PROSITE profilePS5006619.119151IPR002100Transcription factor, MADS-box
CDDcd002662.14E-23287No hitNo description
SuperFamilySSF554552.49E-21298IPR002100Transcription factor, MADS-box
PRINTSPR004045.9E-9323IPR002100Transcription factor, MADS-box
PfamPF003192.8E-181150IPR002100Transcription factor, MADS-box
PRINTSPR004045.9E-92338IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 363 aa     Download sequence    Send to blast
MGRGRLKMEL IANERSRKTT FQKRSKGMMK KAYEFSTLCE VDVCIIIYGP KLTDRPPELQ  60
TWPQNSEQVD RIINKYKAST MSKPAKKTFD LSDMLMDRKN KVYADIYRAR KEMYEAKYPT  120
WDERIESFSE NQLEALLDKL DAKLESGKRT LLNKRNGAAQ RVLVTKKEWM GGNPNMGESS  180
SQKEPCNSYM QDHYHEEDQN PTSSLNNNTV DMLQPFAVSS FDHHQPSDQT LPFDNSDQHL  240
NNLMAPNPSS MAMWMLMEGN YNYSTLQYRA GDSSSQSPLE GYHCNYSDQM NMNMMMTNNN  300
IGPLSSSSMS HYYARLMQPA VPYMHQMMPP SLSSHQLQVH TSQVKEDQYE DINQYLVMNN  360
KMG
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_008232276.2
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008232276.20.0PREDICTED: MADS-box transcription factor 50-like
TrEMBLM5X3X50.0M5X3X5_PRUPE; Uncharacterized protein
STRINGEMJ206190.0(Prunus persica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF53431111
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G55690.18e-24M-type_MADS family protein