PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_008231614.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family M-type_MADS
Protein Properties Length: 199aa    MW: 22501 Da    PI: 9.3187
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_008231614.1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF62.54.9e-201760245
                    ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSE CS
          SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgk 45
                    +i   sn qvtf+kRr g++KKA+EL++ C++e+a+++fs+ +k
  XP_008231614.1 17 KIAKRSNLQVTFCKRRSGLFKKASELCTVCGVEIAIVVFSPANK 60
                    577899***********************************998 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004321.6E-27867IPR002100Transcription factor, MADS-box
PROSITE profilePS5006621.768868IPR002100Transcription factor, MADS-box
SuperFamilySSF554557.46E-25986IPR002100Transcription factor, MADS-box
PRINTSPR004041.0E-151030IPR002100Transcription factor, MADS-box
PfamPF003191.4E-231764IPR002100Transcription factor, MADS-box
PRINTSPR004041.0E-153045IPR002100Transcription factor, MADS-box
PRINTSPR004041.0E-154566IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 199 aa     Download sequence    Send to blast
MMKKKPGQGR QKIPIAKIAK RSNLQVTFCK RRSGLFKKAS ELCTVCGVEI AIVVFSPANK  60
PFSFGHPHVE PIVDRFLCTP KPSIDSDFTS QQLLVDQAQG YMSDSSVHEL NMVLTQTQKH  120
LESEKKRGQE LDEMSKAGQG SSRRCWWENP IDEMGLHEIQ ILKAAMKEVK KNVIEQVNKI  180
LKIQSCAAVN SQYHSSDEW
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. Controls central cell differentiation during female gametophyte development. {ECO:0000269|PubMed:18599653, ECO:0000269|PubMed:18713950}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_008231614.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008231614.11e-148PREDICTED: agamous-like MADS-box protein AGL61
SwissprotQ4PSU41e-49AGL61_ARATH; Agamous-like MADS-box protein AGL61
TrEMBLA0A251QB511e-142A0A251QB51_PRUPE; Uncharacterized protein
STRINGXP_008231614.11e-147(Prunus mume)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF12833331
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G24840.16e-52AGAMOUS-like 61
Publications ? help Back to Top
  1. Zhang S, et al.
    FERTILIZATION-INDEPENDENT SEED-Polycomb Repressive Complex 2 Plays a Dual Role in Regulating Type I MADS-Box Genes in Early Endosperm Development.
    Plant Physiol., 2018. 177(1): p. 285-299
    [PMID:29523711]