PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_008231436.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family GRAS
Protein Properties Length: 461aa    MW: 52324.3 Da    PI: 6.2812
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_008231436.1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS448.25.4e-137444561374
            GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfsh 95 
                     l++lL++cA++v+sg+ e+a+  L ++s+laspdgd+mqR+aayf eALa r+++ +++lykal++++ +  ++see+ + +lf +++P+lk+++
  XP_008231436.1  44 LIQLLYSCANHVASGSIENANIWLDHISQLASPDGDTMQRIAAYFNEALADRMLKAWPGLYKALNSTKIT--SVSEEILVKRLFCDLCPFLKVAY 136
                     689*************************************************************999998..5********************** PP

            GRAS  96 ltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlvakrledle 190
                     +++NqaI+ea+ege++vHiiD+   +++QW+ L+q+L++Rpegpp+lRiTg+++    +ke l ++ +rL++ A +l++pf+fn+ ++++le+l+
  XP_008231436.1 137 VVTNQAIVEAMEGEKMVHIIDLHSCEPAQWIYLIQTLNARPEGPPHLRITGIHE----QKEVLDQMFHRLTEEAGNLNIPFQFNP-IVSKLENLD 226
                     ******************************************************....9**************************.7999***** PP

            GRAS 191 leeLrvkpgEalaVnlvlqlhrll.................................................desvsles.erdevLklvksls 235
                     +e+Lrvk+gEalaV++vlqlh+ll                                                    +s  s +  ++L  +++ls
  XP_008231436.1 227 IESLRVKTGEALAVCSVLQLHSLLaadddlrrksplasknlqkvlhmnkltlgewlekdpisaynlspdsalsP--LSGGSpKMGSFLTSLWGLS 319
                     ********************************************************************888552..3333344778********* PP

            GRAS 236 PkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvpls 330
                     Pk++v++eqe++hn++++++r++eal++y alfd+le+++pr   er+kvE++l+g+ei+n++aceg+er+erhe+lekW  rle aGF+ vpls
  XP_008231436.1 320 PKLMVITEQESNHNGHTLMDRIMEALNFYGALFDCLESTVPRSPMERQKVEKMLFGEEIKNIIACEGTERTERHEKLEKWILRLELAGFGRVPLS 414
                     *********************************************************************************************** PP

            GRAS 331 ekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                     ++ + qa++ l+ ++  g++++ee+g+lv++W+drpL+s+SaWr
  XP_008231436.1 415 YHGMLQARRQLQGYE--GFKIKEENGCLVICWHDRPLFSISAWR 456
                     **************9..**************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098556.51418438IPR005202Transcription factor GRAS
PfamPF035141.9E-13444456IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 461 aa     Download sequence    Send to blast
MAQEDGSPVT SSPLQFFPWL SPGMGSPYPT WLRELKSEER GLYLIQLLYS CANHVASGSI  60
ENANIWLDHI SQLASPDGDT MQRIAAYFNE ALADRMLKAW PGLYKALNST KITSVSEEIL  120
VKRLFCDLCP FLKVAYVVTN QAIVEAMEGE KMVHIIDLHS CEPAQWIYLI QTLNARPEGP  180
PHLRITGIHE QKEVLDQMFH RLTEEAGNLN IPFQFNPIVS KLENLDIESL RVKTGEALAV  240
CSVLQLHSLL AADDDLRRKS PLASKNLQKV LHMNKLTLGE WLEKDPISAY NLSPDSALSP  300
LSGGSPKMGS FLTSLWGLSP KLMVITEQES NHNGHTLMDR IMEALNFYGA LFDCLESTVP  360
RSPMERQKVE KMLFGEEIKN IIACEGTERT ERHEKLEKWI LRLELAGFGR VPLSYHGMLQ  420
ARRQLQGYEG FKIKEENGCL VICWHDRPLF SISAWRFRRY E
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A1e-43444564375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007217978.10.0hypothetical protein PRUPE_ppa005439mg
RefseqXP_008231435.10.0PREDICTED: scarecrow-like protein 3
RefseqXP_008231436.10.0PREDICTED: scarecrow-like protein 3
RefseqXP_008231437.10.0PREDICTED: scarecrow-like protein 3
RefseqXP_008245676.10.0PREDICTED: scarecrow-like protein 3
RefseqXP_008245677.10.0PREDICTED: scarecrow-like protein 3
SwissprotQ9LPR80.0SCL3_ARATH; Scarecrow-like protein 3
TrEMBLM5WZE40.0M5WZE4_PRUPE; Uncharacterized protein
STRINGVIT_13s0019g01220.t010.0(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G50420.10.0scarecrow-like 3