PlantTFDB
Plant Transcription Factor Database
v5.0
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_008231269.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family LBD
Protein Properties Length: 126aa    MW: 14232.3 Da    PI: 6.7242
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_008231269.1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260131.82.9e-4161051100
          DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaela 95 
                     +CaaCk+lrr+C++dC+l+pyfp+++p++f  vh+++Gasnv k+l++l ++ r +a+++l+yeA++r++dP+yG+vgvi++l+qq++ ++ +la
  XP_008231269.1   6 RCAACKYLRRRCPSDCILSPYFPSNDPQRFTSVHRIYGASNVAKMLQELLPHLRVEAAETLCYEAQCRIQDPIYGCVGVISQLHQQIQDTECQLA 100
                     6********************************************************************************************** PP

          DUF260  96 llkee 100
                     ++++e
  XP_008231269.1 101 KTRAE 105
                     99987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089124.5385106IPR004883Lateral organ boundaries, LOB
PfamPF031955.7E-416103IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0016020Cellular Componentmembrane
Sequence ? help Back to Top
Protein Sequence    Length: 126 aa     Download sequence    Send to blast
MNMSGRCAAC KYLRRRCPSD CILSPYFPSN DPQRFTSVHR IYGASNVAKM LQELLPHLRV  60
EAAETLCYEA QCRIQDPIYG CVGVISQLHQ QIQDTECQLA KTRAEIALMM NSDGQEPPQA  120
QVDQQI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A1e-35710612111LOB family transfactor Ramosa2.1
5ly0_B1e-35710612111LOB family transfactor Ramosa2.1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_008231269.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008231269.14e-90PREDICTED: LOB domain-containing protein 24-like
SwissprotP594685e-50LBD24_ARATH; LOB domain-containing protein 24
TrEMBLA0A251Q9A61e-68A0A251Q9A6_PRUPE; Uncharacterized protein
STRINGXP_008231269.12e-89(Prunus mume)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF36973066
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G26660.12e-52LOB domain-containing protein 24