PlantTFDB
Plant Transcription Factor Database
PlantRegMap/PlantTFDB v5.0
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_008230975.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family LBD
Protein Properties Length: 293aa    MW: 32733.7 Da    PI: 6.6587
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_008230975.1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260124.55.4e-39101091100
          DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaela 95 
                     aCaaCk++rr+CakdC+l+p+fpa+qpk f+n+h+l+G+sn++k+ k++++e++++am+s++ye+++ra+ Pv G++g+i++l+ ql+q+ +el 
  XP_008230975.1  10 ACAACKYQRRRCAKDCPLSPHFPADQPKMFQNAHRLYGVSNIMKIRKQVHPEQQNEAMRSIIYESNMRAKFPVTGCMGIINQLNFQLQQAIEELR 104
                     7*********************************************************************************************9 PP

          DUF260  96 llkee 100
                     +++++
  XP_008230975.1 105 YVRTH 109
                     99876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089123.9719110IPR004883Lateral organ boundaries, LOB
PfamPF031951.1E-3610107IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 293 aa     Download sequence    Send to blast
MTIKGGTSQA CAACKYQRRR CAKDCPLSPH FPADQPKMFQ NAHRLYGVSN IMKIRKQVHP  60
EQQNEAMRSI IYESNMRAKF PVTGCMGIIN QLNFQLQQAI EELRYVRTHL AICRDQCQYR  120
IPPSPPHYSS CPSSQLQLGM PSNNDASAAL TIYQHQYQYA SAGGGAAGMS FLANEYLANG  180
LSAVYIDDND VVKPLRVQHP YYSDNNVDQL MAVQSNLVSS QAFPIHQEMD VPHDYDDIPF  240
DTIADDRQSY IESKEACESS AESSFRGTTQ SIEHVSQNDL KSAAACFSLT SVK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A1e-2361107111LOB family transfactor Ramosa2.1
5ly0_B1e-2361107111LOB family transfactor Ramosa2.1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_008230975.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008230975.10.0PREDICTED: LOB domain-containing protein 27-like
TrEMBLM5WV190.0M5WV19_PRUPE; Uncharacterized protein
STRINGXP_008230975.10.0(Prunus mume)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF44152958
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G47870.12e-43LOB domain-containing protein 27