PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_008230746.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family HD-ZIP
Protein Properties Length: 309aa    MW: 35119 Da    PI: 7.0775
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_008230746.1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox57.32.7e-1889141456
                     -SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
        Homeobox   4 RttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                     + +++ eq+++Le+ Fe+ +++  e++ +LAk lgL+ rq+ +WFqNrRa++k
  XP_008230746.1  89 KKRLNLEQVKTLEKSFEMGNKLEPERKMQLAKALGLQPRQIAIWFQNRRARWK 141
                     4568889*********************************************9 PP

2HD-ZIP_I/II129.51.3e-4187177191
     HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreel 91 
                     ekk+rl+ eqvk+LE+sFe+ +kLeperK++la++Lglqprq+a+WFqnrRAR+ktkqlEkdy++Lk+++dalk++n+ L++++++L++el
  XP_008230746.1  87 EKKKRLNLEQVKTLEKSFEMGNKLEPERKMQLAKALGLQPRQIAIWFQNRRARWKTKQLEKDYDVLKKKFDALKADNDVLQDHNNKLQAEL 177
                     69**************************************************************************************998 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.97E-1979145IPR009057Homeodomain-like
PROSITE profilePS5007117.02283143IPR001356Homeobox domain
SMARTSM003891.2E-1786147IPR001356Homeobox domain
CDDcd000868.79E-1788144No hitNo description
PfamPF000461.7E-1589141IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.601.4E-1991151IPR009057Homeodomain-like
PRINTSPR000311.1E-5114123IPR000047Helix-turn-helix motif
PROSITE patternPS000270118141IPR017970Homeobox, conserved site
PRINTSPR000311.1E-5123139IPR000047Helix-turn-helix motif
PfamPF021836.2E-14143183IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 309 aa     Download sequence    Send to blast
MMAFPSCHSF MFQTHEDPDL HLANSSSLNN LPSCPPQHFH GGGVPFMMKR SLSFSGVENN  60
KCHHHEEVGL HGGGEDDLSD DGSQIGEKKK RLNLEQVKTL EKSFEMGNKL EPERKMQLAK  120
ALGLQPRQIA IWFQNRRARW KTKQLEKDYD VLKKKFDALK ADNDVLQDHN NKLQAELLSM  180
KSKDSNEAGL NNINNLKKET DQGSRSNGSE NSSDHHHHHH HLNLDISRTP ATTNSSPSNS  240
QQTNGKNLFP SSLRPTSITQ LLQGSSRSDL QCLKVDQMIQ DESLCSMFNG IDQEQQQGYW  300
PWPEQHHFH
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1135143RRARWKTKQ
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_008230746.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT1404395e-57BT140439.1 Lotus japonicus clone JCVI-FLLj-18M14 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008230746.10.0PREDICTED: homeobox-leucine zipper protein ATHB-20-like
SwissprotQ004669e-86HAT7_ARATH; Homeobox-leucine zipper protein HAT7
TrEMBLA0A251Q6380.0A0A251Q638_PRUPE; Uncharacterized protein
STRINGXP_008230746.10.0(Prunus mume)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF127133106
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G01220.13e-70homeobox protein 20