PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_008229662.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family GRAS
Protein Properties Length: 446aa    MW: 48581.1 Da    PI: 5.9805
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_008229662.1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS375.75.9e-115844433374
            GRAS   3 elLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshlt 97 
                      lLl+cAe+v+ ++l +a+ lL ++ el+sp g++ +R+ ayf+ AL++r+ +s+ ++y+ l++++ +  +s++ ++al+ ++ +sP++kfsh+t
  XP_008229662.1  84 GLLLQCAECVAMDSLDEASDLLPEIAELSSPFGSSPERVGAYFAHALQTRVISSCLGTYSPLTTKTLTVAQSQRIFNALQSYNSISPLVKFSHFT 178
                     58********************************************************************************************* PP

            GRAS  98 aNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlvakrledlele 192
                      NqaI +a++ge++vH+iD+di+qGlQWp L++ LasR+++  s+RiTg+gs    s+e le+tg+rLa+fA++lg+pfef++l  k  +  el+
  XP_008229662.1 179 SNQAIFQALDGEDHVHVIDLDIMQGLQWPGLFHILASRSKKIRSMRITGFGS----SSELLESTGRRLADFASSLGLPFEFRPLEGKIGSITELS 269
                     ****************************************************....9**************************988888999*** PP

            GRAS 193 eLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvEr 287
                     +L v+p+Ea++V++++  h l+d ++s       +L+l+ sl+Pk+++++eq+++h s+sFl rf+eal+yysalfd+l  +l+++s er++vE+
  XP_008229662.1 270 QLGVRPDEATVVHWMH--HCLYDVTGSDLA----TLRLLGSLRPKLITIAEQDLSH-SGSFLGRFVEALHYYSALFDALGDGLGADSLERHMVEQ 357
                     ***************9..888877777777....**********************.899*********************************** PP

            GRAS 288 ellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                     +l+g ei+n++a  g +r+ + + +e+W + l+++GF+pv+l+ + a+qa+lll +++++gy++ ee+g+l lgWkd +L+++SaW+
  XP_008229662.1 358 QLFGCEIRNILAVGGPKRTGEVK-VERWGDELKRVGFRPVSLGGNPAAQASLLLGMFPWKGYTLVEENGCLKLGWKDLSLLTASAWQ 443
                     *****************998887.9*************************************************************6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098555.79156423IPR005202Transcription factor GRAS
PfamPF035142.1E-11284443IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0048366Biological Processleaf development
GO:0090610Biological Processbundle sheath cell fate specification
GO:0005634Cellular Componentnucleus
Sequence ? help Back to Top
Protein Sequence    Length: 446 aa     Download sequence    Send to blast
MLQSLVPQSP IGAANPNNNP SSSSSSMKTK RVDRDLAGGE SSGEDPSFTK RPNSGRNFSR  60
EKTSDEREKE PVAEGESAGL RLLGLLLQCA ECVAMDSLDE ASDLLPEIAE LSSPFGSSPE  120
RVGAYFAHAL QTRVISSCLG TYSPLTTKTL TVAQSQRIFN ALQSYNSISP LVKFSHFTSN  180
QAIFQALDGE DHVHVIDLDI MQGLQWPGLF HILASRSKKI RSMRITGFGS SSELLESTGR  240
RLADFASSLG LPFEFRPLEG KIGSITELSQ LGVRPDEATV VHWMHHCLYD VTGSDLATLR  300
LLGSLRPKLI TIAEQDLSHS GSFLGRFVEA LHYYSALFDA LGDGLGADSL ERHMVEQQLF  360
GCEIRNILAV GGPKRTGEVK VERWGDELKR VGFRPVSLGG NPAAQASLLL GMFPWKGYTL  420
VEENGCLKLG WKDLSLLTAS AWQPLD
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A3e-50824434375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008229662.10.0PREDICTED: scarecrow-like protein 23
SwissprotQ9FHZ10.0SCL23_ARATH; Scarecrow-like protein 23
TrEMBLM5WRZ70.0M5WRZ7_PRUPE; Uncharacterized protein
STRINGGLYMA11G10220.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF20683489
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G41920.10.0GRAS family protein