PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_008229654.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family FAR1
Protein Properties Length: 834aa    MW: 95472.8 Da    PI: 6.9859
Description FAR1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_008229654.1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FAR175.61e-23100186291
            FAR1   2 fYneYAkevGFsvrkskskkskrngeitkrtfvCskegkreeekkktekerrtraetrtgCkaklkvkkekdgkwevtkleleHnHelap 91 
                     +Y+eYA++vGF +++++s++sk++g++++ +  Cs+ g+++e+ ++    + +   t+t+Cka+l++k+++dgkw+v+++ +eHnHe++p
  XP_008229654.1 100 YYREYARSVGFGITIKASRRSKKSGKFIDIKIACSRFGSKRESGTT---VNPRLCITKTDCKASLHIKRKDDGKWVVHSFIKEHNHEMCP 186
                     9*****************************************9888...5666789********************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031012.0E-21100186IPR004330FAR1 DNA binding domain
PfamPF105511.5E-25269360IPR018289MULE transposase domain
PROSITE profilePS5096610.076548584IPR007527Zinc finger, SWIM-type
PfamPF044349.2E-7548581IPR007527Zinc finger, SWIM-type
SMARTSM005751.7E-7559586IPR006564Zinc finger, PMZ-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 834 aa     Download sequence    Send to blast
MEIDLELPSC EQDKLETGSD KDVNVVDVTD EKNVEEHVNS PTSEHVKEAD GLDANQSACS  60
LQAQDDAKNM GLNAVDEGKR VIQEPQNGLE FESKEEAYSY YREYARSVGF GITIKASRRS  120
KKSGKFIDIK IACSRFGSKR ESGTTVNPRL CITKTDCKAS LHIKRKDDGK WVVHSFIKEH  180
NHEMCPDDFI YAISGRNKKP ATVACQKKGL QSALGEEDVR VMFEHFMCMQ DEDPNFFYAI  240
DFDLEKRLRS VFWIDAKCRH DYSSFCDAVF FDTYYVRNNY RIPFVPIVGV NHHFQYILLG  300
CALMGEETIP AFVWLMRTWL KVVGGQAPRL IITDQDKYLK EAVADVFTDA YHCFCLWHVL  360
SRIPENVGFF IKENEIFMEK FNKCIYRSWT VEQFEKKWWK LVDRFELREN EWVHSLFEDR  420
KKWVPTYMQD SFMAGMSTRE RSGSITSFFD RYISQEATVN DFIEQYKGFQ KDMYDMEVNA  480
ALETQDKQPG LRSLSTFEKQ MATIYTGSVF KKFKVEVLGL ASCQLQKDGE NEATAIFRVD  540
DLEERQNFTV SWNDAELKVC CSCHSFEYKG FLCRHAILVL QVSGVSSIPS HYILKRWTKD  600
AKVRCTVSDG PKRLNYRVQR FNDLCKLAVK LGEEGSLSPE TYHIAFQALE AALKHCVDAN  660
NSVRTVSEAN MSANHGFNDV EEVNPSSNMA KSSKKKKTYK KRKAQTEQDS LTIRLQDSCQ  720
QMEHGSRSRG LDSYYGAQQS MPGMGQMNSI APISDGYYGN QQATQGQLHS LPTRVGHYGT  780
QQSMRGMGQL SFRSPTVQSC FDIQGNLQDM EHSAGSSHFH GNASKRPHGK HQTQ
Functional Description ? help Back to Top
Source Description
UniProtPutative transcription activator involved in regulating light control of development.
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_008229654.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Up-regulated in hypocotyls by far-red light treatment. {ECO:0000269|PubMed:15591448}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008229654.10.0PREDICTED: protein FAR1-RELATED SEQUENCE 2 isoform X3
SwissprotQ3EBQ30.0FRS2_ARATH; Protein FAR1-RELATED SEQUENCE 2
TrEMBLA0A251Q2E80.0A0A251Q2E8_PRUPE; Uncharacterized protein
STRINGXP_008229651.10.0(Prunus mume)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G32250.40.0FAR1-related sequence 2
Publications ? help Back to Top
  1. Joly-Lopez Z, et al.
    Abiotic Stress Phenotypes Are Associated with Conserved Genes Derived from Transposable Elements.
    Front Plant Sci, 2017. 8: p. 2027
    [PMID:29250089]