PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_008229200.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family GeBP
Protein Properties Length: 292aa    MW: 33000.3 Da    PI: 7.9124
Description GeBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_008229200.1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF57379.16.8e-2560153397
          DUF573   3 fqrlwseeDeivlLqGlidfkaktgkspsddidafyefvkksisfkvsksqlveKirrLKkKfkkkvkkaksgkepsfskehdqkifelskkiWg 97 
                      +r+w+e De+++LqGl+d+ a+ g s  +d++ fy  ++  +s +++ksql+eK+rr++kKf+  +++ ++g + s  ++hd+  ++ls+k+W 
  XP_008229200.1  60 YHRIWTEPDEVLFLQGLLDC-ASDGFSFPKDLHLFYARFSTTVSQQYTKSQLSEKLRRFRKKFRVVSARLARGLHESQLSPHDRALYDLSRKLWS 153
                     68******************.77899*99*****************************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF045045.5E-2661153IPR007592Protein of unknown function DUF573
Sequence ? help Back to Top
Protein Sequence    Length: 292 aa     Download sequence    Send to blast
MDSIKPSSAT KLPIKRKNPD HIPNPNPNLL PPNLESTAIY DYNAVVFSAE EGQRTPPFKY  60
HRIWTEPDEV LFLQGLLDCA SDGFSFPKDL HLFYARFSTT VSQQYTKSQL SEKLRRFRKK  120
FRVVSARLAR GLHESQLSPH DRALYDLSRK LWSSECWSTS PFGNKAKSDE GDDNLMVNQN  180
QSVLDNLFVE NDYGDEVKMI NLSRPIAGLA AKAVLDVFDQ SLNEVRMVLV QHCLLCPDHV  240
GSVSGSGSGS CSSNKGKTAL DFERQWQLQR LAELDVLSQR LRLVLDNTIR GQ
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_008229200.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008229200.10.0PREDICTED: mediator-associated protein 1-like
TrEMBLA0A314YM100.0A0A314YM10_PRUYE; Mediator-associated protein 1-like
STRINGXP_008229200.10.0(Prunus mume)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF1654199
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G28040.13e-12DNA-binding storekeeper protein-related transcriptional regulator