PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_008228265.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family GeBP
Protein Properties Length: 398aa    MW: 43554.9 Da    PI: 7.7011
Description GeBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_008228265.1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF5731162.2e-36169263198
          DUF573   1 klfqrlwseeDeivlLqGlidfkaktgkspsddidafyefvkksisfkvsksqlveKirrLKkKfkkkvkkaksgkepsfskehdqkifelskki 95 
                     klfqr+ws++Dei++L+G+id+ +k+g++p++d+ af++f+kks++++v+k+ql +Kirr+KkK++++v+k   gk+ +  k+h+qk f+lskk+
  XP_008228265.1 169 KLFQRIWSDDDEITILKGMIDYSTKKGADPYSDMGAFHDFIKKSLKADVNKTQLQDKIRRIKKKYETNVAK---GKKYNPVKPHEQKLFDLSKKV 260
                     579********************************************************************...999999*************** PP

          DUF573  96 Wgs 98 
                     Wgs
  XP_008228265.1 261 WGS 263
                     *95 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF045047.2E-34171262IPR007592Protein of unknown function DUF573
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005730Cellular Componentnucleolus
GO:0005829Cellular Componentcytosol
GO:0009507Cellular Componentchloroplast
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 398 aa     Download sequence    Send to blast
MAPKRPSPLD EPPAASSSDE EVASSEEEVD GEEEEESGSG SESESEEPEP PKAAPTPVAA  60
KKPDSATVNS KPQSSSSGSE SESESDSELD KDRVVKPIVS KPMEETPKTK KPRSKASALT  120
TPAARAGLKR PSESDLKDSK RPKKKVTDPD QEREHAGEEK KAGGDDSKKL FQRIWSDDDE  180
ITILKGMIDY STKKGADPYS DMGAFHDFIK KSLKADVNKT QLQDKIRRIK KKYETNVAKG  240
KKYNPVKPHE QKLFDLSKKV WGSGEGSIGL SGLSEQSKSN GKARTNQKGN KTLASLKAEL  300
LSSPERPKEC EKVEFGLKPS GSESLSEVIG FDKGFRELGL PEGVVKQGLE LIGGAKRAEL  360
KEKWKKLHVA ELELFVKKSE LMRDQAKVIL EALKSSEH
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008228265.10.0PREDICTED: mediator-associated protein 1-like
TrEMBLM5WQU90.0M5WQU9_PRUPE; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF18313490
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G61730.16e-33DNA-binding storekeeper protein-related transcriptional regulator