PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_008228238.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family M-type_MADS
Protein Properties Length: 208aa    MW: 23468.9 Da    PI: 4.3979
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_008228238.1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF45.59.6e-15953145
                    S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSE CS
          SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgk 45
                    k+i+nk   + tfskRr+g++ KA  L+ L +a++a+i fs+ +k
  XP_008228238.1  9 KKINNKNYLKATFSKRRKGLFRKATDLCCLSGAQIAIITFSPGNK 53
                    68999************************************9876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006619.525161IPR002100Transcription factor, MADS-box
SuperFamilySSF554553.27E-22171IPR002100Transcription factor, MADS-box
SMARTSM004322.0E-22160IPR002100Transcription factor, MADS-box
PRINTSPR004046.4E-12323IPR002100Transcription factor, MADS-box
PfamPF003191.4E-161057IPR002100Transcription factor, MADS-box
PRINTSPR004046.4E-122338IPR002100Transcription factor, MADS-box
PRINTSPR004046.4E-123859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 208 aa     Download sequence    Send to blast
MGKKKIDIKK INNKNYLKAT FSKRRKGLFR KATDLCCLSG AQIAIITFSP GNKPFIFGHP  60
SAETVIDRFL GEQASCTMYD DDDEGIGPVD GEDGHEDLEV SHDEEDIRSV DAEDSHDDSE  120
AHQEEEKEDE AGGDGEKVSV WWDEPIDENL GLHELKKYKG LLECLKENVA SKLDEMNKRE  180
FYTKDYLAML NSEIGSTSTT CQERDLCH
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_008228238.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008228238.11e-153PREDICTED: agamous-like MADS-box protein AGL62
TrEMBLA0A314Z9M71e-139A0A314Z9M7_PRUYE; Agamous-like MADS-box protein AGL62
STRINGXP_008228238.11e-153(Prunus mume)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF12833331
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60440.12e-25AGAMOUS-like 62