PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_008228232.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family NF-YA
Protein Properties Length: 298aa    MW: 33035.9 Da    PI: 9.5079
Description NF-YA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_008228232.1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CBFB_NFYA101.86.5e-32139195158
       CBFB_NFYA   1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58 
                     dep+YVNaKQy++Il+RRq Rakle+++kl  k rkpylheSRh hAl+R+RgsgGrF
  XP_008228232.1 139 DEPIYVNAKQYRAILRRRQYRAKLEAQNKL-VKIRKPYLHESRHVHALKRARGSGGRF 195
                     79****************************.**************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005218.8E-36137198IPR001289Nuclear transcription factor Y subunit A
PROSITE profilePS5115236.126138198IPR001289Nuclear transcription factor Y subunit A
PfamPF020455.4E-26140195IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006166.0E-23141163IPR001289Nuclear transcription factor Y subunit A
PROSITE patternPS006860143163IPR018362CCAAT-binding factor, conserved site
PRINTSPR006166.0E-23172195IPR001289Nuclear transcription factor Y subunit A
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0016602Cellular ComponentCCAAT-binding factor complex
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 298 aa     Download sequence    Send to blast
MGLPLQNCHN RKQSGIHFQD QDSSSTQSTG QSHSEVDSMK EGNPCGEGIV SAQSAYNERQ  60
GKPVGGHLKS LSSMASQGFV FPSQLDFSHP MGHIPFHYAE PYFGSLLAAA CGPQATIHHP  120
QVMGITPARV PLPLDLTEDE PIYVNAKQYR AILRRRQYRA KLEAQNKLVK IRKPYLHESR  180
HVHALKRARG SGGRFLNMKK VQDSKPNTTN HRVDVSGSAQ LHLTRNMSES EVHEPENYRD  240
GASTTSCSEV TSTSNSDNIF PRQDFRFSGY PSHIGGTMQV PFVDVRGGGN QHHISLLR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4awl_A3e-19139199262NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtStimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_008228232.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016649370.10.0PREDICTED: nuclear transcription factor Y subunit A-3 isoform X1
RefseqXP_016649371.10.0PREDICTED: nuclear transcription factor Y subunit A-3 isoform X1
RefseqXP_016649372.10.0PREDICTED: nuclear transcription factor Y subunit A-3 isoform X1
RefseqXP_016649373.10.0PREDICTED: nuclear transcription factor Y subunit A-3 isoform X1
RefseqXP_016649374.10.0PREDICTED: nuclear transcription factor Y subunit A-3 isoform X1
RefseqXP_016649375.10.0PREDICTED: nuclear transcription factor Y subunit A-3 isoform X1
SwissprotQ93ZH23e-72NFYA3_ARATH; Nuclear transcription factor Y subunit A-3
TrEMBLA0A314XXE20.0A0A314XXE2_PRUYE; Nuclear transcription factor Y subunit A-3 isoform X1
STRINGXP_008228224.10.0(Prunus mume)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G72830.12e-62nuclear factor Y, subunit A3