PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_008228223.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family M-type_MADS
Protein Properties Length: 172aa    MW: 19658.9 Da    PI: 4.7484
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_008228223.1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF43.83.2e-14954146
                    S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEE CS
          SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgkl 46
                    k+i+nk   + tfskRr g++ KA  L+ L +a++a+i fs+ +k 
  XP_008228223.1  9 KKINNKNYLKATFSKRRRGLFSKATDLCCLSGAQIAIITFSPGNKT 54
                    6899*************************************99885 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004321.3E-20160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006619.049161IPR002100Transcription factor, MADS-box
SuperFamilySSF554552.09E-21282IPR002100Transcription factor, MADS-box
PRINTSPR004049.2E-12323IPR002100Transcription factor, MADS-box
PfamPF003193.7E-151057IPR002100Transcription factor, MADS-box
PRINTSPR004049.2E-122338IPR002100Transcription factor, MADS-box
PRINTSPR004049.2E-123859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 172 aa     Download sequence    Send to blast
MGTRKINIKK INNKNYLKAT FSKRRRGLFS KATDLCCLSG AQIAIITFSP GNKTFLFGNP  60
SAKAVLDRFL GEQDSCTSDD HHEESLGSTP EDSDHEDLEA SRKESSEIED VMDEDRVNFW  120
WDDPIDDELG IYELRSYKGL LEALKENVAS KLDDMNRREF STKDFLSMFR NS
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_008228223.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008228223.11e-125PREDICTED: agamous-like MADS-box protein AGL62
TrEMBLA0A251NQQ61e-106A0A251NQQ6_PRUPE; MADS-box protein 25
STRINGXP_008228223.11e-124(Prunus mume)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF12833331
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60440.12e-28AGAMOUS-like 62