PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_008228199.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family GRF
Protein Properties Length: 363aa    MW: 40508.4 Da    PI: 8.7407
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_008228199.1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC794.5e-2578122145
             WRC   1 daepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkskee 45 
                     d+epgrCrRtDGKkWRCs+++++++k+CErH+hrgr+rsrk++e 
  XP_008228199.1  78 DPEPGRCRRTDGKKWRCSKEAYPDSKYCERHMHRGRNRSRKPVEV 122
                     79****************************************985 PP

2QLQ57.34.9e-201448236
             QLQ  2 aFTaaQlqlLksQilAyKyLaanqPvPpeLlqaiq 36
                    +FT++Q+q+L++Q+l++Ky+a++ P+P +L++ ++
  XP_008228199.1 14 PFTPNQWQELEHQALIFKYMASGIPIPTDLVFSLK 48
                    9******************************9887 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009511.1E-101349IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166622.1871449IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088801.3E-141446IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166725.32578122IPR014977WRC domain
PfamPF088793.4E-2179121IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0048366Biological Processleaf development
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 363 aa     Download sequence    Send to blast
MLSGNPNTAR NRYPFTPNQW QELEHQALIF KYMASGIPIP TDLVFSLKRR LDNSISSRLF  60
PHPMGWGCYE MGFGRKVDPE PGRCRRTDGK KWRCSKEAYP DSKYCERHMH RGRNRSRKPV  120
EVSSSTTTPS TTTTATEHPS SSSSSALSSP NNKNLSKTSS YSLSPLSSSM STETQTQHHP  180
HQSNSPLYPF LNYPQSSSSS SRPPPGSVFS PQNNSSSATP HLFLNSGSYN TQAEKDYRYL  240
HGTKGSVDEL AFFPESSANG RSILTGGSSS CQPLMSSYRG YSQPQFQSLT DHHNPEVSQQ  300
SQEEEQHCFV WGTDFKSSRA IKTEKEAAET QKSLHHFFGD WQPPKSTDTW LDLSSNSGVP  360
NDG
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKC7700706e-97KC770070.1 Pyrus pyrifolia microsatellite TXY185 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008228199.10.0PREDICTED: growth-regulating factor 5 isoform X2
TrEMBLM5XAI30.0M5XAI3_PRUPE; Uncharacterized protein
STRINGGLYMA07G04290.11e-119(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13960.12e-61growth-regulating factor 5