PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_008228195.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family GRAS
Protein Properties Length: 549aa    MW: 61324.4 Da    PI: 6.2027
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_008228195.1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS2591.7e-791575412374
            GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshl 96 
                     ++lL  cA a++ g+l+++q+lL  l+elas +gd+++Rlaa+ ++AL ++l++sv++ +++ pp + ++++     ++l  f+evsP++ f + 
  XP_008228195.1 157 EQLLNPCALAITCGNLTRVQHLLYVLHELASLTGDANHRLAAHGLRALTQHLSSSVPHGSASAPPVTFASTEPRFFQKSLLKFYEVSPWFAFPNN 251
                     689******************************************************************8888888888888************* PP

            GRAS  97 taNqaIleavege....ervHiiDfdisqGlQWpaLlqaLasRp.egppslRiTgvgspesg..............skeeleetgerLakfAeel 172
                     +aN+ Il+ +++e    + +Hi+D ++s+G+QWp+Ll+aL+ Rp ++pp ++iT+v++++++                    +   rL  fA+++
  XP_008228195.1 252 IANSSILQLIAEEsdrtRNLHIVDVGVSHGMQWPTLLEALTRRPgGPPPLVKITVVSAAANTennqnrenretpfsIGPPGDNFSFRLLGFAKSM 346
                     ********999998777889************************55566********98888888766655544444444566778********* PP

            GRAS 173 gvpfefnvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadh...nsesFlerflealeyy 264
                     ++++++n l  + l++l+ + ++++++E l+V+++++lh+l    +++++er+e+Lk++++++Pk v+++e+++++   n ++F+++f++ +ey 
  XP_008228195.1 347 NINLQINRLDNQPLQNLNAQVIDTSNDELLIVCVQFRLHNLN---HNTPDERTEFLKALRNMEPKGVILSENNMECscnNCGDFATGFSRQVEYL 438
                     ********9999*****************************8...77777889*******************9665446778************* PP

            GRAS 265 salfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvk.sdgyrveeesgsl 358
                     + ++ds+++ +    + r + Er++++ e+ ++++++g++    +e + kW er++ +GF    ++e+a +  ++llrk++ ++++r++e++g++
  XP_008228195.1 439 WRFLDSTSSAF----KGRESDERRVMEGEAAKALTNRGEM----NEGKDKWCERMKGVGFVGQVFGEDAIDGGRALLRKYDnNWEMRMDEKDGCA 525
                     *******6665....5555556666666699999999998....9************************************9999********** PP

            GRAS 359 vlgWkdrpLvsvSaWr 374
                      l Wk++p+ ++S W+
  XP_008228195.1 526 GLWWKGQPVSFCSLWK 541
                     ***************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098539.209130520IPR005202Transcription factor GRAS
PfamPF035146.1E-77157541IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0042446Biological Processhormone biosynthetic process
GO:2000032Biological Processregulation of secondary shoot formation
Sequence ? help Back to Top
Protein Sequence    Length: 549 aa     Download sequence    Send to blast
MTTQEPEPNS TSDHILDWLE DSVTFFPTFL DDPYHSNDIN GLQWWDESHD LIHSNTTSTS  60
LNNLTSIALP TTTRPPNPTN LNQQSPSDSS KKQKVSDDQH IDQKNHVRPI SQAGQGDQLV  120
EDIVVPVKRT NGNKKSTAKT TGNNCNNGNS KEGRWAEQLL NPCALAITCG NLTRVQHLLY  180
VLHELASLTG DANHRLAAHG LRALTQHLSS SVPHGSASAP PVTFASTEPR FFQKSLLKFY  240
EVSPWFAFPN NIANSSILQL IAEESDRTRN LHIVDVGVSH GMQWPTLLEA LTRRPGGPPP  300
LVKITVVSAA ANTENNQNRE NRETPFSIGP PGDNFSFRLL GFAKSMNINL QINRLDNQPL  360
QNLNAQVIDT SNDELLIVCV QFRLHNLNHN TPDERTEFLK ALRNMEPKGV ILSENNMECS  420
CNNCGDFATG FSRQVEYLWR FLDSTSSAFK GRESDERRVM EGEAAKALTN RGEMNEGKDK  480
WCERMKGVGF VGQVFGEDAI DGGRALLRKY DNNWEMRMDE KDGCAGLWWK GQPVSFCSLW  540
KTDVKVSNS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A7e-2118454125375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008228195.10.0PREDICTED: nodulation-signaling pathway 1 protein
SwissprotQ4VYC80.0NSP1_MEDTR; Nodulation-signaling pathway 1 protein
TrEMBLM5X9410.0M5X941_PRUPE; Uncharacterized protein
STRINGVIT_09s0002g01190.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF68743447
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13840.11e-162GRAS family protein