PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_008227332.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family M-type_MADS
Protein Properties Length: 429aa    MW: 48623.7 Da    PI: 4.0255
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_008227332.1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF25.81.3e-082667950
                    HHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS
          SRF-TF  9 rqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50
                    +++  +kR  ++  KA  LS LCd+ v +i ++ +gk+ +++
  XP_008227332.1 26 QKTAMAKRGSTLKNKAGRLSKLCDIAVYMIALGADGKINDWP 67
                    568899***********************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF554551.31E-72683IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 429 aa     Download sequence    Send to blast
MALPKSNPRV SASMKMKRVS DAMKPQKTAM AKRGSTLKNK AGRLSKLCDI AVYMIALGAD  60
GKINDWPENQ QDLKSVLLKY KNLKRGFKDR IEKGLFSVEK GFLEIVDDRE NRDLGIQDNC  120
LGAKLESLNE RIGAVTMEMM MRDDGKCSFM DLYKNIMEPD PADQQQLSSL NLNLNLHPTD  180
LVEPRPKPNL IGEINLNLDP GDLVIPTPKP NLIGQINLNL DPDNVVIPTP KPNLIGQFQQ  240
DYLSSIHEPT VDANDYLSLV LDNDDHNDVG LMEDYLQLYD LELPEEPQEQ LQSQSPSVPS  300
VEISDDDMKL LLSDCEIGLM EDDMQFCDDL DDYEPTVDTI YDFLSWVLGD EDQNDNNAME  360
DDVQPHSTYH ITDDEHDDIR LLLTDCEIGL MQEDLQFCDN DLSEFLAPLQ TMLLQDPQHQ  420
PHSELNLNF
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_008227332.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008227332.10.0PREDICTED: uncharacterized protein LOC103326856
TrEMBLA0A251NP840.0A0A251NP84_PRUPE; Uncharacterized protein
STRINGXP_008227332.10.0(Prunus mume)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF1714726
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G18650.18e-08AGAMOUS-like 103