PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_008227312.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family M-type_MADS
Protein Properties Length: 448aa    MW: 50053.5 Da    PI: 4.0142
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_008227312.1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF27.15.2e-092567850
                    HHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS
          SRF-TF  8 nrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50
                     r++  +kR  ++  KA  LS LCd+ v +i ++ +g++ +++
  XP_008227312.1 25 PRKTAMAKRGSTLKNKAGRLSKLCDIAVYMIALGADGEINDWP 67
                    599***************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF554558.37E-82483IPR002100Transcription factor, MADS-box
PROSITE profilePS500668.7462670IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 448 aa     Download sequence    Send to blast
MALPKSNPRV SVSMKMKRVS DAMKPRKTAM AKRGSTLKNK AGRLSKLCDI AVYMIALGAD  60
GEINDWPENQ QDLKSVLLKY KNLKRGFKDQ IEKGLFSVEK GFLEFVDDGE NRDLGIQDNC  120
LGAKLESLNE RIGAVTMKMM MMRDDGKRSF MDLYKNIMEP DAADQQQQSS LNLNLNLHPT  180
DLVIPTPKPN LIGEINLNLD PGDLVIPTPK PNLIGQINLN LDPGNVVIPT PKPNLIGQFQ  240
QDYLSSIHEP TVDANDYLSL VLGNDDHNDV GLMEDYLQLY DLELPEEPQE QLQPQPPSVP  300
SVEISDDDMK LLLSDCEIGL MEDDMQFCDN LDDYEPTVDT IYDFLSWVLG DEDQIDNGVM  360
EDDLHPQSTN HNGVSSTEGL KIDGPDVVNV GPSMSITDDD IWLLLTDCAI GLMQEDDDND  420
LSDFLAPLET MLLQVPQHQP HSELNLNF
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_008227312.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008227304.10.0PREDICTED: uncharacterized protein LOC103326831 isoform X1
RefseqXP_008227312.10.0PREDICTED: uncharacterized protein LOC103326831 isoform X2
RefseqXP_016649699.10.0PREDICTED: uncharacterized protein LOC103326831 isoform X3
TrEMBLA0A251NP840.0A0A251NP84_PRUPE; Uncharacterized protein
STRINGXP_008227312.10.0(Prunus mume)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G18650.13e-09AGAMOUS-like 103