PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_008227238.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family GRAS
Protein Properties Length: 474aa    MW: 52999.1 Da    PI: 5.8609
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_008227238.1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS467.57.6e-143494711374
            GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfsh 95 
                     l++lLl+cA++v++g+le+a+ +L+++s+las dgd+mqR+aayfteALa r+++ +++l +al++++ s   +see+ ++k+f+e+ P+lk+++
  XP_008227238.1  49 LIHLLLTCANHVATGSLENANVALEQISQLASADGDTMQRIAAYFTEALADRILKAWPGLHRALNSTKIS--LVSEEFLVRKVFFEMLPFLKVAF 141
                     689*************************************************************999998..79********************* PP

            GRAS  96 ltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlvakrledle 190
                     ++aNqaI ea+ege++vH+iD+++ +++QW+aLlq L++Rpegpp+lRiTgv++    +ke l ++++rL++ Ae+l++pf+f + ++++le+l+
  XP_008227238.1 142 VLANQAITEAMEGEKMVHVIDLNAAEPAQWIALLQVLSARPEGPPHLRITGVHQ----QKEVLDQMAHRLTEEAEKLDIPFQFCP-IVSKLENLD 231
                     ******************************************************....9**************************.7999***** PP

            GRAS 191 leeLrvkpgEalaVnlvlqlhrll......................................................desvsles..erdevLk 229
                     +e+Lr+k+gEala+++vlqlh+ll                                                      ++++sl+   + d++L+
  XP_008227238.1 232 MEKLRIKTGEALAISSVLQLHSLLasddellkkksplasksssgiplprvlqmnqgtlgellekemgngysaspdstsSSPLSLTAsmKLDSFLN 326
                     ***************************************************************************99944444444447799*** PP

            GRAS 230 lvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGF 324
                     +++sl Pkv+v++eq+++hn+++++er+leal+ y+alfd+le++++r+s er kvE++l+g+ei+n++aceg er+erhe+lekW +rl+ aGF
  XP_008227238.1 327 AFWSLTPKVMVITEQDSNHNGSTLMERLLEALYSYAALFDCLESTMSRNSIERLKVEKMLFGEEIKNIIACEGCERKERHEKLEKWIQRLDLAGF 421
                     *********************************************************************************************** PP

            GRAS 325 kpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                     ++vpls++ + qak+ll+ ++ dgyr+ ee+g++++ W+drpL+svSaWr
  XP_008227238.1 422 GNVPLSYYGMLQAKRLLQGYGCDGYRMREENGCVLISWQDRPLFSVSAWR 471
                     *************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098558.76123451IPR005202Transcription factor GRAS
PfamPF035142.6E-14049471IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009739Biological Processresponse to gibberellin
GO:0005634Cellular Componentnucleus
Sequence ? help Back to Top
Protein Sequence    Length: 474 aa     Download sequence    Send to blast
MTPMFQDEGS SSATSSPLQF FSMMSLSPSL GSPYPWLKEL KSEERGLYLI HLLLTCANHV  60
ATGSLENANV ALEQISQLAS ADGDTMQRIA AYFTEALADR ILKAWPGLHR ALNSTKISLV  120
SEEFLVRKVF FEMLPFLKVA FVLANQAITE AMEGEKMVHV IDLNAAEPAQ WIALLQVLSA  180
RPEGPPHLRI TGVHQQKEVL DQMAHRLTEE AEKLDIPFQF CPIVSKLENL DMEKLRIKTG  240
EALAISSVLQ LHSLLASDDE LLKKKSPLAS KSSSGIPLPR VLQMNQGTLG ELLEKEMGNG  300
YSASPDSTSS SPLSLTASMK LDSFLNAFWS LTPKVMVITE QDSNHNGSTL MERLLEALYS  360
YAALFDCLES TMSRNSIERL KVEKMLFGEE IKNIIACEGC ERKERHEKLE KWIQRLDLAG  420
FGNVPLSYYG MLQAKRLLQG YGCDGYRMRE ENGCVLISWQ DRPLFSVSAW RCRK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A2e-45494714375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008227238.10.0PREDICTED: scarecrow-like protein 3
SwissprotQ9LPR80.0SCL3_ARATH; Scarecrow-like protein 3
TrEMBLM5WFN20.0M5WFN2_PRUPE; Uncharacterized protein
STRINGVIT_06s0009g02390.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF23833484
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G50420.10.0scarecrow-like 3