PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_008227067.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family M-type_MADS
Protein Properties Length: 298aa    MW: 32911.4 Da    PI: 4.3958
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_008227067.1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF34.62.4e-1139741550
                    HHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS
          SRF-TF 15 kRrngilKKAeELSvLCdaevaviifsstgklyeys 50
                    +R   + K A+ELS+LCd+ v+v+ ++ + ++ +++
  XP_008227067.1 39 RRMSNLKKMASELSILCDVAVCVVAVGADSEIETWP 74
                    444455556**************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500668.6063777IPR002100Transcription factor, MADS-box
SuperFamilySSF554556.28E-93890IPR002100Transcription factor, MADS-box
PfamPF003191.5E-83973IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 298 aa     Download sequence    Send to blast
MAPPQLKSKK PKKMKMKMKP QVLKIDANGG SVLKPPLARR MSNLKKMASE LSILCDVAVC  60
VVAVGADSEI ETWPENQQDA KSILLEHKNL GKLGKKIEKG SFSVGKGTDY SFLDTMLGGL  120
NERIGVVMMR DGGTKTRTTS TCSFMEFYEN IMGTSVLPDP PDQQQSMLLV DQVPHHQQED  180
YCTTNSDGFY LEDLHIAAAA PTLSNIDEYV SWLLDDHNDI GLMEDYIQFG DSDLAPLPLE  240
SQEQPAQMDT NNSDHLSWLL GGGDIGLMED YIQICDSDLA SPLDPQQPPS LQLPQTTY
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_008227067.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008227067.10.0PREDICTED: uncharacterized protein LOC103326603
TrEMBLA0A314UGL41e-163A0A314UGL4_PRUYE; Uncharacterized protein
STRINGXP_008227067.10.0(Prunus mume)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF1714726