PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_008226677.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family NAC
Protein Properties Length: 371aa    MW: 41188.1 Da    PI: 8.2285
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_008226677.1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM172.31.5e-53281551128
             NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk 95 
                     lppGfrFhPtdeelvv+yLkkkv++ +l++  +i+ev++yk++Pw+Lp+k++ +e+ewyfFs+rd+ky++g r+nra++sgyWkatg+dk+vl++
  XP_008226677.1  28 LPPGFRFHPTDEELVVHYLKKKVTSAPLPV-AIIAEVELYKFDPWELPAKATFGEQEWYFFSPRDRKYPNGARPNRAATSGYWKATGTDKPVLTS 121
                     79****************************.88***************988899***************************************99 PP

             NAM  96 .kgelvglkktLvfykgrapkgektdWvmheyrl 128
                      ++++vg+kk Lvfy g+ pkg kt+W+mheyrl
  XP_008226677.1 122 gGTQKVGVKKALVFYGGKPPKGIKTNWIMHEYRL 155
                     77788***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019412.35E-6423189IPR003441NAC domain
PROSITE profilePS5100561.79928189IPR003441NAC domain
PfamPF023651.6E-2829155IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009753Biological Processresponse to jasmonic acid
GO:0045995Biological Processregulation of embryonic development
GO:0048317Biological Processseed morphogenesis
GO:0080060Biological Processintegument development
GO:0005634Cellular Componentnucleus
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 371 aa     Download sequence    Send to blast
MESTDSSTGS QQQQQQQQQP QPPPQPNLPP GFRFHPTDEE LVVHYLKKKV TSAPLPVAII  60
AEVELYKFDP WELPAKATFG EQEWYFFSPR DRKYPNGARP NRAATSGYWK ATGTDKPVLT  120
SGGTQKVGVK KALVFYGGKP PKGIKTNWIM HEYRLADNKT SNKPPGCDLG NKKNSLRLDD  180
WVLCRIYKKN NSHRPMDLER EDSMEDMMGP LMLPSISHVG HHQNMNLHLP KSDTNYGPPF  240
IENDPIFFDG IMSSTNGSAS LSNGTSQLPL KRSIVPSFYW NDQDDNQTAG ASSSKRVVQL  300
HQLDSGTNNS ASDGINGAPN NNSTSIANLL SQLPQTPPLH QHAMLGSLGD GLFRTPYQLP  360
GMNWFSESNL G
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A3e-74181927168NO APICAL MERISTEM PROTEIN
1ut4_B3e-74181927168NO APICAL MERISTEM PROTEIN
1ut7_A3e-74181927168NO APICAL MERISTEM PROTEIN
1ut7_B3e-74181927168NO APICAL MERISTEM PROTEIN
3swm_A4e-741819210171NAC domain-containing protein 19
3swm_B4e-741819210171NAC domain-containing protein 19
3swm_C4e-741819210171NAC domain-containing protein 19
3swm_D4e-741819210171NAC domain-containing protein 19
3swp_A4e-741819210171NAC domain-containing protein 19
3swp_B4e-741819210171NAC domain-containing protein 19
3swp_C4e-741819210171NAC domain-containing protein 19
3swp_D4e-741819210171NAC domain-containing protein 19
4dul_A3e-74181927168NAC domain-containing protein 19
4dul_B3e-74181927168NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor of the NAC family (Probable). Together with NAC018/NARS2, regulates embryogenesis by regulating the development and degeneration of ovule integuments, a process required for intertissue communication between the embryo and the maternal integument (PubMed:18849494). {ECO:0000269|PubMed:18849494, ECO:0000305}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00361DAPTransfer from AT3G15510Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_008226677.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By Jasmonic acid (JA). {ECO:0000269|PubMed:16805732}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKR8227080.0KR822708.1 Prunus persica NAC transcription factor NAC1 (NAC1) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008226677.10.0PREDICTED: NAC transcription factor 56
SwissprotQ9LD441e-120NAC56_ARATH; NAC transcription factor 56
TrEMBLM5WG300.0M5WG30_PRUPE; NAC transcription factor NAC1
STRINGXP_008226677.10.0(Prunus mume)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF16233498
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G15510.11e-122NAC domain containing protein 2
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]