PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_008224041.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family M-type_MADS
Protein Properties Length: 202aa    MW: 21938.4 Da    PI: 4.3846
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_008224041.1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF56.73e-18959151
                    S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
          SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                    ++ienk  r vtfs+Rrng++KKA+  S L +  va++++s+ g+ y+y+s
  XP_008224041.1  9 EKIENKQSRLVTFSRRRNGLFKKAKDFSNLSGSSVAILVISPAGRRYTYAS 59
                    57***********************************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006623.731161IPR002100Transcription factor, MADS-box
SMARTSM004321.1E-24160IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.96E-22171IPR002100Transcription factor, MADS-box
PRINTSPR004043.8E-15323IPR002100Transcription factor, MADS-box
PfamPF003193.2E-191057IPR002100Transcription factor, MADS-box
PRINTSPR004043.8E-152338IPR002100Transcription factor, MADS-box
PRINTSPR004043.8E-153859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 202 aa     Download sequence    Send to blast
MGKKKIAIEK IENKQSRLVT FSRRRNGLFK KAKDFSNLSG SSVAILVISP AGRRYTYASP  60
SFDSVVDQFL SETIDGSSTV TDGSSSFDYV DDQFLPTTNA GSTSVDSMVD QFLSTEAASP  120
SYDSVIDEFL STAIGSPSVD STADQIVPIA TVDSSTTTTS GSFRDTLKAL SDINIEACND  180
LEELMTLKNN LEQIIRERTR LI
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_008224041.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008224041.11e-143PREDICTED: MADS-box protein FLOWERING LOCUS C-like
TrEMBLA0A251QSL41e-130A0A251QSL4_PRUPE; MADS-box protein 24
STRINGXP_008224041.11e-142(Prunus mume)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF1648159
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G34440.11e-14AGAMOUS-like 29