PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_008223344.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family GRAS
Protein Properties Length: 441aa    MW: 49215 Da    PI: 6.0177
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_008223344.1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS264.53.5e-81554281374
            GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlar.svselykalppsetsekn..sseelaalkl......fse 86 
                     l +lLl++Ae v++++  +a++l +  + l+s+ g+++qR++ yft+AL+++  r ++ + ++  ++++         +e++a ++      f e
  XP_008223344.1  55 LAHLLLAFAEKVAKQQYGCARKLQNLCHFLSSSCGNSVQRVVYYFTKALQEKTDReTGRNASEGSESRDV---LamYFQEAMASSTpalmacFLE 146
                     579*****************9988888888************************9233333333333333...2332333333333344444777 PP

            GRAS  87 vsPilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegpp.slRiTgvgspesgskeeleetgerLakfAeelgvpfefnv 180
                     v P+++++ ++  qaI+e+v++++++H iD+ i  G++ + L+qaLa+R e p   l++T+vg    +s+e++e tg+rLa+fAe+l++pf+f+v
  XP_008223344.1 147 V-PFYQITEFAGIQAIVESVASAKKIHFIDLAIRTGGHCIVLMQALATRYECPIeLLKVTAVGV---TSREKIEDTGRRLAQFAEALKLPFSFKV 237
                     5.***********************************************97665499*******...68************************** PP

            GRAS 181 lvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleakl 275
                      ++k+++d++ ++++++ gEa aV + l l ++++++ ++es    ++k+++ l+P+++v++e ea+hns++F +rf eal yysa f++l++ +
  XP_008223344.1 238 AMVKDIKDVNEDTFELEDGEAAAVYCPLLLCSTMRQPNCSES----LIKVLRYLNPRLMVITEIEANHNSPTFTNRFNEALLYYSAYFECLDVCM 328
                     9********************************999999988....************************************************* PP

            GRAS 276 preseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvk.sdgyrveeesgslvlgWkdrpLvs 369
                      r s  r+ +E+ +l+ ei+n++a eg+er+ r+ +   Wr  + e+G+ +++ls +   qa+l+ ++++ +   +++ + + lv gWk+ p++s
  XP_008223344.1 329 DRGSAYRMELEETYLSLEIKNIIASEGKERIIRCMKIDAWRTLFAECGMVEAELSLSSLYQADLVAKQFAcGSCCTLDTNGKGLVVGWKGTPILS 423
                     **********************************************************************9999********************* PP

            GRAS 370 vSaWr 374
                     +S+W+
  XP_008223344.1 424 LSVWK 428
                     ****8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098539.55329407IPR005202Transcription factor GRAS
PfamPF035141.2E-7855428IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 441 aa     Download sequence    Send to blast
MSCVPGLSTV EVMRIARASF IQFSSWRYAD DCMPARVLGS APLGLSDQET KDVELAHLLL  60
AFAEKVAKQQ YGCARKLQNL CHFLSSSCGN SVQRVVYYFT KALQEKTDRE TGRNASEGSE  120
SRDVLAMYFQ EAMASSTPAL MACFLEVPFY QITEFAGIQA IVESVASAKK IHFIDLAIRT  180
GGHCIVLMQA LATRYECPIE LLKVTAVGVT SREKIEDTGR RLAQFAEALK LPFSFKVAMV  240
KDIKDVNEDT FELEDGEAAA VYCPLLLCST MRQPNCSESL IKVLRYLNPR LMVITEIEAN  300
HNSPTFTNRF NEALLYYSAY FECLDVCMDR GSAYRMELEE TYLSLEIKNI IASEGKERII  360
RCMKIDAWRT LFAECGMVEA ELSLSSLYQA DLVAKQFACG SCCTLDTNGK GLVVGWKGTP  420
ILSLSVWKFH AVNAKTAKYL M
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A1e-348542833375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008223344.10.0PREDICTED: DELLA protein GAI1-like
TrEMBLM5Y8020.0M5Y802_PRUPE; Uncharacterized protein
STRINGPOPTR_0010s15330.11e-152(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF47933162
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G03450.12e-52RGA-like 2