PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_008223286.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family ARR-B
Protein Properties Length: 676aa    MW: 73965.9 Da    PI: 6.2097
Description ARR-B family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_008223286.1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like90.51.4e-28213266155
         G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                     kpr++W+ eLH++Fv av+qL G++kA+Pk+ilelm+v+gLt+e+v+SHLQkYRl
  XP_008223286.1 213 KPRVVWSVELHQQFVGAVNQL-GIDKAVPKKILELMNVPGLTRENVASHLQKYRL 266
                     79*******************.********************************8 PP

2Response_reg75.32.4e-25351431109
                     EEEESSSHHHHHHHHHHHHHTTCEEEEEESSHHHHHHHHHHHH..ESEEEEESSCTTSEHHHHHHHHHHHTTTSEEEEEESTTTHHHHHHHHHTT CS
    Response_reg   1 vlivdDeplvrellrqalekegyeevaeaddgeealellkekd..pDlillDiempgmdGlellkeireeepklpiivvtahgeeedalealkaG 93 
                     vl+vdD+p+ +++l+++l+   y ev+ +  +e al+ll+e++  +D+++ D+ mp+mdG++ll++   e  +lp+i+++a + ++ + + +  G
  XP_008223286.1  35 VLVVDDDPTCLMILEKMLRTCLY-EVTKCNRAEIALNLLRENKngYDIVISDVHMPDMDGFKLLERVGLEM-DLPVIMMSADDGKSVVMKGVTHG 127
                     89*********************.***************999999**********************6644.8********************** PP

                     ESEEEESS--HHHHHH CS
    Response_reg  94 akdflsKpfdpeelvk 109
                     a d+l Kp+ +e+l +
  XP_008223286.1 128 ACDYLIKPVRIEALKN 143
                     ************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0363921.4E-1839668IPR017053Response regulator B-type, plant
SuperFamilySSF521721.14E-3432157IPR011006CheY-like superfamily
Gene3DG3DSA:3.40.50.23006.0E-4232173No hitNo description
SMARTSM004483.2E-3033145IPR001789Signal transduction response regulator, receiver domain
PROSITE profilePS5011042.54134149IPR001789Signal transduction response regulator, receiver domain
PfamPF000721.3E-2235143IPR001789Signal transduction response regulator, receiver domain
CDDcd001563.31E-2736148No hitNo description
PROSITE profilePS512949.894210269IPR017930Myb domain
SuperFamilySSF466898.96E-20210270IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.606.6E-30212271IPR009057Homeodomain-like
TIGRFAMsTIGR015571.7E-24213266IPR006447Myb domain, plants
PfamPF002495.5E-7215265IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009414Biological Processresponse to water deprivation
GO:0009873Biological Processethylene-activated signaling pathway
GO:0010082Biological Processregulation of root meristem growth
GO:0010119Biological Processregulation of stomatal movement
GO:0010150Biological Processleaf senescence
GO:0010380Biological Processregulation of chlorophyll biosynthetic process
GO:0031537Biological Processregulation of anthocyanin metabolic process
GO:0080022Biological Processprimary root development
GO:0080036Biological Processregulation of cytokinin-activated signaling pathway
GO:0080113Biological Processregulation of seed growth
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 676 aa     Download sequence    Send to blast
MNLSNGMGSM STASSSGAWK SADVVSDQFP AGLRVLVVDD DPTCLMILEK MLRTCLYEVT  60
KCNRAEIALN LLRENKNGYD IVISDVHMPD MDGFKLLERV GLEMDLPVIM MSADDGKSVV  120
MKGVTHGACD YLIKPVRIEA LKNIWQHVVR KKKNEWKEVE QSGSVEEGDR QPKPSEDADY  180
SSSANEGTWK NSKRRKDEEE EADERDDSST LKKPRVVWSV ELHQQFVGAV NQLGIDKAVP  240
KKILELMNVP GLTRENVASH LQKYRLYLRR LSGVSQHPSN LNNSFLSPQE ASFGAMSSLN  300
GLDLQTLAVT GQLPAQSLAT LQAGLGRSTA KSGMPMPLVD QRNLFSFENP KLRFAEGQQH  360
LSSSKPMNLL HGIPTNMEAK QLANLHQSAQ SLGGVNMQVN AHGVQNSALL MQMSQPQSRG  420
QILNETSGNH VPRLSSSMGQ PILSNGIPSG VLGRNGIADN GRGAGYNPVQ QNSSMLNFPL  480
NNSSELPGNN FTLGSTPGMS SLTSKGAFPE DVNCEIKRSS GFAPSYDIFN ELHQHKSNDW  540
DLQNVGLTFD ASQHTNTMHG SLDSSVLVHQ GFSSSQRSVQ SRNPSTVGKA MFSIGEGTHH  600
VNVQNNGQHL NSLIVDNTVR VKAERVPDAS SQTSYFNEQF GQEDLMSALL KQQQEGIGAT  660
ENEFDFDGYS LDNIPV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A1e-21212272464ARR10-B
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator that binds specifically to the DNA sequence 5'-[AG]GATT-3'. Functions as a response regulator involved in His-to-Asp phosphorelay signal transduction system. Phosphorylation of the Asp residue in the receiver domain activates the ability of the protein to promote the transcription of target genes. Could directly activate some type-A response regulators in response to cytokinins. Involved in the expression of nuclear genes for components of mitochondrial complex I. Promotes cytokinin-mediated leaf longevity. Involved in the ethylene signaling pathway in an ETR1-dependent manner and in the cytokinin signaling pathway. {ECO:0000269|PubMed:11370868, ECO:0000269|PubMed:11574878, ECO:0000269|PubMed:15282545, ECO:0000269|PubMed:16407152}.
UniProtTranscriptional activator that binds specifically to the DNA sequence 5'-[AG]GATT-3'. Functions as a response regulator involved in His-to-Asp phosphorelay signal transduction system. Phosphorylation of the Asp residue in the receiver domain activates the ability of the protein to promote the transcription of target genes. Could directly activate some type-A response regulators in response to cytokinins. Regulates SHY2 by binding to its promoter (PubMed:19039136). Involved in the root-meristem size determination through the regulation of cell differentiation (PubMed:17363254). {ECO:0000269|PubMed:11574878, ECO:0000269|PubMed:11691951, ECO:0000269|PubMed:17363254, ECO:0000269|PubMed:19039136}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00054PBMTransfer from AT4G16110Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_008223286.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Down-regulated by gibberellin. {ECO:0000269|PubMed:20605455}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008223286.10.0PREDICTED: two-component response regulator ARR2 isoform X1
SwissprotQ940D00.0ARR1_ARATH; Two-component response regulator ARR1
SwissprotQ9ZWJ90.0ARR2_ARATH; Two-component response regulator ARR2
TrEMBLA0A251QWL70.0A0A251QWL7_PRUPE; Two-component response regulator
STRINGXP_008223286.10.0(Prunus mume)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF39583458
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G16857.20.0response regulator 1
Publications ? help Back to Top
  1. Bürkle L,Meyer S,Dortay H,Lehrach H,Heyl A
    In vitro recombination cloning of entire cDNA libraries in Arabidopsis thaliana and its application to the yeast two-hybrid system.
    Funct. Integr. Genomics, 2005. 5(3): p. 175-83
    [PMID:15714319]
  2. Moubayidin L, et al.
    Spatial coordination between stem cell activity and cell differentiation in the root meristem.
    Dev. Cell, 2013. 26(4): p. 405-15
    [PMID:23987513]
  3. Takahashi N, et al.
    Cytokinins control endocycle onset by promoting the expression of an APC/C activator in Arabidopsis roots.
    Curr. Biol., 2013. 23(18): p. 1812-7
    [PMID:24035544]
  4. Kurepa J,Li Y,Perry SE,Smalle JA
    Ectopic expression of the phosphomimic mutant version of Arabidopsis response regulator 1 promotes a constitutive cytokinin response phenotype.
    BMC Plant Biol., 2014. 14: p. 28
    [PMID:24423196]
  5. Cortleven A, et al.
    A novel protective function for cytokinin in the light stress response is mediated by the Arabidopsis histidine kinase2 and Arabidopsis histidine kinase3 receptors.
    Plant Physiol., 2014. 164(3): p. 1470-83
    [PMID:24424319]
  6. Ge XM, et al.
    Heterotrimeric G protein mediates ethylene-induced stomatal closure via hydrogen peroxide synthesis in Arabidopsis.
    Plant J., 2015. 82(1): p. 138-50
    [PMID:25704455]
  7. Takahashi N,Umeda M
    Cytokinins promote onset of endoreplication by controlling cell cycle machinery.
    Plant Signal Behav, 2014. 9(8): p. e29396
    [PMID:25763620]
  8. Marín-de la Rosa N, et al.
    Genome Wide Binding Site Analysis Reveals Transcriptional Coactivation of Cytokinin-Responsive Genes by DELLA Proteins.
    PLoS Genet., 2015. 11(7): p. e1005337
    [PMID:26134422]
  9. D'Alessandro S,Golin S,Hardtke CS,Lo Schiavo F,Zottini M
    The co-chaperone p23 controls root development through the modulation of auxin distribution in the Arabidopsis root meristem.
    J. Exp. Bot., 2015. 66(16): p. 5113-22
    [PMID:26163704]
  10. Jiang L, et al.
    Strigolactones spatially influence lateral root development through the cytokinin signaling network.
    J. Exp. Bot., 2016. 67(1): p. 379-89
    [PMID:26519957]
  11. Moubayidin L, et al.
    A SCARECROW-based regulatory circuit controls Arabidopsis thaliana meristem size from the root endodermis.
    Planta, 2016. 243(5): p. 1159-68
    [PMID:26848984]
  12. Muraro D, et al.
    A multi-scale model of the interplay between cell signalling and hormone transport in specifying the root meristem of Arabidopsis thaliana.
    J. Theor. Biol., 2016. 404: p. 182-205
    [PMID:27157127]
  13. Cortleven A, et al.
    Cytokinin Regulates the Etioplast-Chloroplast Transition through the Two-Component Signaling System and Activation of Chloroplast-Related Genes.
    Plant Physiol., 2016. 172(1): p. 464-78
    [PMID:27388681]
  14. Kobayashi K, et al.
    Shoot Removal Induces Chloroplast Development in Roots via Cytokinin Signaling.
    Plant Physiol., 2017. 173(4): p. 2340-2355
    [PMID:28193764]
  15. Arnaud D, et al.
    Cytokinin-Mediated Regulation of Reactive Oxygen Species Homeostasis Modulates Stomatal Immunity in Arabidopsis.
    Plant Cell, 2017. 29(3): p. 543-559
    [PMID:28254779]
  16. Zhang TQ, et al.
    A Two-Step Model for de Novo Activation of WUSCHEL during Plant Shoot Regeneration.
    Plant Cell, 2017. 29(5): p. 1073-1087
    [PMID:28389585]
  17. Kushwah S,Laxmi A
    The interaction between glucose and cytokinin signaling in controlling Arabidopsis thaliana seedling root growth and development.
    Plant Signal Behav, 2017. 12(5): p. e1312241
    [PMID:28467152]
  18. Meng WJ, et al.
    Type-B ARABIDOPSIS RESPONSE REGULATORs Specify the Shoot Stem Cell Niche by Dual Regulation of WUSCHEL.
    Plant Cell, 2017. 29(6): p. 1357-1372
    [PMID:28576846]
  19. Kobayashi K,Iwase A
    Simultaneous but spatially different regulation of non-photosynthetic callus formation and photosynthetic root development after shoot removal.
    Plant Signal Behav, 2017. 12(6): p. e1338999
    [PMID:28594268]
  20. Liu B,De Storme N,Geelen D
    Cold interferes with male meiotic cytokinesis in Arabidopsis thaliana independently of the AHK2/3-AHP2/3/5 cytokinin signaling module.
    Cell Biol. Int., 2017. 41(8): p. 879-889
    [PMID:28618065]
  21. Zhang F,May A,Irish VF
    Type-B ARABIDOPSIS RESPONSE REGULATORs Directly Activate WUSCHEL.
    Trends Plant Sci., 2017. 22(10): p. 815-817
    [PMID:28886911]
  22. Yan Z, et al.
    Type B Response Regulators Act As Central Integrators in Transcriptional Control of the Auxin Biosynthesis Enzyme TAA1.
    Plant Physiol., 2017. 175(3): p. 1438-1454
    [PMID:28931628]
  23. Rong XF, et al.
    Type-B ARRs Control Carpel Regeneration Through Mediating AGAMOUS Expression in Arabidopsis.
    Plant Cell Physiol., 2018. 59(4): p. 756-764
    [PMID:29186581]
  24. Bustillo-Avendaño E, et al.
    Regulation of Hormonal Control, Cell Reprogramming, and Patterning during De Novo Root Organogenesis.
    Plant Physiol., 2018. 176(2): p. 1709-1727
    [PMID:29233938]
  25. Waldie T,Leyser O
    Cytokinin Targets Auxin Transport to Promote Shoot Branching.
    Plant Physiol., 2018. 177(2): p. 803-818
    [PMID:29717021]
  26. Takatsuka H,Higaki T,Umeda M
    Actin Reorganization Triggers Rapid Cell Elongation in Roots.
    Plant Physiol., 2018. 178(3): p. 1130-1141
    [PMID:30185441]