PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_008222760.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family M-type_MADS
Protein Properties Length: 403aa    MW: 44405.9 Da    PI: 7.9867
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_008222760.2genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF48.21.4e-151153345
                    --SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSE CS
          SRF-TF  3 ienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgk 45
                    i n+s r+++f kR++g+lKK +ELS+LCd+    ii+++++k
  XP_008222760.2 11 ITNDSARKTSFRKRKEGLLKKLSELSILCDVSGFAIIYGPDDK 53
                    89*************************************9975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006616.624153IPR002100Transcription factor, MADS-box
SMARTSM004322.7E-21160IPR002100Transcription factor, MADS-box
CDDcd002661.25E-28285No hitNo description
SuperFamilySSF554558.37E-23295IPR002100Transcription factor, MADS-box
PRINTSPR004043.4E-7323IPR002100Transcription factor, MADS-box
PfamPF003191.6E-141153IPR002100Transcription factor, MADS-box
PRINTSPR004043.4E-72338IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 403 aa     Download sequence    Send to blast
MTRKKVKLAW ITNDSARKTS FRKRKEGLLK KLSELSILCD VSGFAIIYGP DDKEPVVWPS  60
RPIAEELLAR FQRIPEVDRC KKMMNQETYL NDRLAKLKEQ LTKTHRKNKE MEMNIIMSQI  120
QEGKPLNEFG ACELTCLVLF LEEKIKEIWK RIKYLGHEAN LPLGAFSPHE GGDAENTTVP  180
DEWNPTESSY NYFSKEKGKQ SQNMSVVTAS NNNVMGNMGL PPHASFGSTS GINVSKEMRL  240
LRENFGISRS SDIGFMFGNI KGDMSNVGSD FGTSFGRFGD KKYRNDIDWS YENLGASSDG  300
SGIGLPHVNN GLLQTHYGNV NGSSSSNVRN DAGDIGGING GYDNIEEHIP QPSNITGGFG  360
SNVGVPHGAG SDTGLPNGLS RESNAGSDAG VLYDISKTRK RSF
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1224RKKVKLAWITNDSARKTSFRKRK
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_008222760.2
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008222760.20.0PREDICTED: uncharacterized protein LOC103322608
TrEMBLA0A251QYV60.0A0A251QYV6_PRUPE; Uncharacterized protein
STRINGEMJ225190.0(Prunus persica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF110141938
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G48670.12e-26AGAMOUS-like 80