PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_008222757.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family M-type_MADS
Protein Properties Length: 368aa    MW: 40263.3 Da    PI: 5.1368
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_008222757.1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF38.51.5e-121151343
                    --SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TT CS
          SRF-TF  3 ienksnrqvtfskRrngilKKAeELSvLCdaevaviifsst 43
                    i n+  r+ +f kR++ +lKK +E+ +LCd+ + +i+++++
  XP_008222757.1 11 IVNDAARKSSFRKRKACLLKKMSEINTLCDVSAFIIVYGPD 51
                    779999*********************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006614.549149IPR002100Transcription factor, MADS-box
SMARTSM004322.4E-13160IPR002100Transcription factor, MADS-box
CDDcd002661.74E-24285No hitNo description
SuperFamilySSF554556.15E-22394IPR002100Transcription factor, MADS-box
PfamPF003197.1E-131157IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 368 aa     Download sequence    Send to blast
MARNKVKLAW IVNDAARKSS FRKRKACLLK KMSEINTLCD VSAFIIVYGP DSDKPTVWPD  60
RPLVEQVVAR FQSIPELERW KKMMSQETYL KDRVAKMQEQ IKNILKKNNE LNANEILYQS  120
IQKGKSLLAF EDNDLTDLVL SLEDRMKEIQ NRIDYFEKPN PSHPVRIPPE ESGGQSENMS  180
QIYGDFTEFL LWYKDLGKQI GNTNGPTSSV RSDLGVPSTA YFGSLTHENE MGLPNWNFGG  240
SNYDGSDLGL AMQIDNSEGQ GYAGSGMGMS MVNYGGITSG IEMGFGMFPS NGNNVVGSTE  300
DTGLGTGGSM ADKGNAGSRI EFPPRFLGGN KDGSDSGLPP GLFGGRIAGS VGLPYDVSKS  360
GQNLFSSP
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_008222757.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008222757.10.0PREDICTED: agamous-like MADS-box protein AGL8
TrEMBLA0A2H4G3840.0A0A2H4G384_PRUPE; MADS-box protein 36
STRINGXP_008222757.10.0(Prunus mume)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF110141938
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G48670.12e-25AGAMOUS-like 80