PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_008222480.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family FAR1
Protein Properties Length: 252aa    MW: 28372.9 Da    PI: 7.3034
Description FAR1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_008222480.1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FAR191.41.2e-2888175291
            FAR1   2 fYneYAkevGFsvrkskskkskrngeitkrtfvCskegkreeekkktekerrtraetrtgCkaklkvkkekdgkwevtkleleHnHelap 91 
                     fYn+YA++vGF +r+sk ++s+r+g+ + r +vC+keg+r ++k++  k  r+raetr+gC+a++ v+k ++gkw+vtk+++eH+H+l+p
  XP_008222480.1  88 FYNAYATRVGFIIRVSKLSRSRRDGSAIGRALVCNKEGYRMPDKRE--KIVRQRAETRVGCRAMILVRKVSSGKWVVTKFVKEHTHPLTP 175
                     ******************************************9988..9**************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031017.4E-2688175IPR004330FAR1 DNA binding domain
Sequence ? help Back to Top
Protein Sequence    Length: 252 aa     Download sequence    Send to blast
MEFSVDGDVS GEVVGSSAEL EISRAGDENE TGGSSIEGAF QLGQDDKMNQ DSPGKDIIPQ  60
AVPVVSVVPA DEPYVGQEFE TEAAAHAFYN AYATRVGFII RVSKLSRSRR DGSAIGRALV  120
CNKEGYRMPD KREKIVRQRA ETRVGCRAMI LVRKVSSGKW VVTKFVKEHT HPLTPGKGRR  180
DCIYDQYPNE HDKIRELSQQ LAIEKKRAAT YKRHLDLIFE HIEEHNESLS KKIQHIVESV  240
KEIEGKEQQQ HR
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_008222480.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008222480.10.0PREDICTED: protein FAR1-RELATED SEQUENCE 2
TrEMBLA0A251R0030.0A0A251R003_PRUPE; Uncharacterized protein
STRINGXP_008222480.10.0(Prunus mume)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF24533072
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G59470.21e-101FAR1 family protein