PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_008222477.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family FAR1
Protein Properties Length: 209aa    MW: 24217.5 Da    PI: 8.9277
Description FAR1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_008222477.1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FAR184.71.5e-2644132290
            FAR1   2 fYneYAkevGFsvrkskskkskrngeitkrtfvCskegkreeekkktekerrtraetrtgCkaklkvkkekdgkwevtkleleHnHela 90 
                     fY+eYA++vGF +r+ + ++s+r+g+i  r++ C+keg+  + + k    r++ra+tr gCka+++vk +k++kw++tk+ ++HnH+l+
  XP_008222477.1  44 FYDEYARRVGFVMRVMSCRRSERDGRILARRLGCNKEGHCVSIRGKFGPVRKPRASTREGCKAMIHVKYDKSSKWVITKFIKDHNHPLV 132
                     9**************************************99999998****************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031014.0E-2444132IPR004330FAR1 DNA binding domain
Sequence ? help Back to Top
Protein Sequence    Length: 209 aa     Download sequence    Send to blast
MDSDEGARAV ESSSSQALVL YEADSILEPY EGMEFESEDA AKIFYDEYAR RVGFVMRVMS  60
CRRSERDGRI LARRLGCNKE GHCVSIRGKF GPVRKPRAST REGCKAMIHV KYDKSSKWVI  120
TKFIKDHNHP LVVSPREARQ TMDEKDKKIQ ELTAELRNKK RLCTTYQEQL TAFTKIVEEY  180
SDQLSKKVQN VVSNLKEFES IDRELSQHR
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_008222477.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008222477.11e-155PREDICTED: protein FAR1-RELATED SEQUENCE 5-like isoform X1
RefseqXP_016648093.11e-155PREDICTED: protein FAR1-RELATED SEQUENCE 5-like isoform X1
RefseqXP_020409810.11e-155protein FAR1-RELATED SEQUENCE 5
RefseqXP_020409811.11e-155protein FAR1-RELATED SEQUENCE 5
RefseqXP_021833156.11e-155protein FAR1-RELATED SEQUENCE 5-like
TrEMBLA0A251R2Y81e-154A0A251R2Y8_PRUPE; Uncharacterized protein
STRINGXP_008222477.11e-155(Prunus mume)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF96531104
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G43280.11e-111FAR1 family protein