PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_008222405.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family GRAS
Protein Properties Length: 707aa    MW: 80697.9 Da    PI: 6.6917
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_008222405.2genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS386.14e-1183357053374
            GRAS   3 elLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshlt 97 
                     +lL++cA+av+s d++ a++lL+++++++sp+gd+ +Rla+yf+ +L+arla++ + ly+ l + +t+    +e l+a++l++  +P+ k+ h+ 
  XP_008222405.2 335 TLLTQCAQAVASYDQRTASELLKQIRKHSSPYGDAAERLAHYFADGLEARLAGTRTPLYSPLLSIQTP---AAEILKAYQLYVTHCPYKKMLHFF 426
                     69************************************************************999998...8*********************** PP

            GRAS  98 aNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakrledle 190
                      N++I++ +e+++r+HiiDf+is+G+QWp+++q L++Rp+gpp++R+T+++ p++g   +e++eetg+rL k+A++++vpf+++v +a+++e+++
  XP_008222405.2 427 SNRTIMKLAEKATRLHIIDFGISYGFQWPCFIQRLSKRPGGPPNIRMTAIELPQPGfrPTERVEETGRRLDKYAKRFNVPFQYKV-IAQKWETIQ 520
                     *******************************************************9****************************9.7******** PP

            GRAS 191 leeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikv 285
                     +e+L+++++E ++Vn++++l++++de+v  +s+rd+vLkl+k+++P++ ++   +  +ns+ Fl+rf eal ++sa fd++ea++pre+e+r + 
  XP_008222405.2 521 FEDLKIDRDELIVVNCMHRLKHIPDETVMASSPRDTVLKLIKRINPDLYIHGVINGAYNSPFFLTRFREALFHFSAQFDMFEATIPREDEQRLMF 615
                     *********************************************************************************************** PP

            GRAS 286 ErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvk.sdgyrveeesgslvlgWkdrpLvsvSaWr 374
                     E++++g++i+nv+aceg er+er et+++W+ r ++aGFk++pl+++  k++k++l+ ++  + +r++e+ +++++gWk+r ++ + +W+
  XP_008222405.2 616 EKAVFGKDIMNVIACEGLERVERPETYKQWQVRYQRAGFKQLPLDQELLKKVKTMLKVMGyHNDFRIDEDGHWMLQGWKGRIIMGLAFWK 705
                     **********************************************************999999*************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098566.413307684IPR005202Transcription factor GRAS
PfamPF035141.4E-115335705IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 707 aa     Download sequence    Send to blast
MDTLLERLSV SKEKFHFGHG SIPVHSNQNL VNGFQVNHEP TNPPFLPTNS DHPSDSSTSL  60
SSGSDGDTFD ISDCSQPVLK YISDILLEED LEGKPCMLQD CLALQAAEKS FYDVLNQKDP  120
PSPNQPPLSD HQSFENSDDD STHSCHRSND YRAEQTDWVL DSSETSHVQS SLVESPPDNL  180
LASDSLYGNF GGVGEARKLL PNENFGIIDL EKYQFMSQGP NTPFRNLASK RENDGYNSTN  240
RSKEKKNHQR EDGDYAEEGR SNKQSAASAD DSEPQEMFDK VLLCSVNHES ECCSHDEPLK  300
NEGSGKLKPN KQSKGSKTAR SKKQNNKREV VDFSTLLTQC AQAVASYDQR TASELLKQIR  360
KHSSPYGDAA ERLAHYFADG LEARLAGTRT PLYSPLLSIQ TPAAEILKAY QLYVTHCPYK  420
KMLHFFSNRT IMKLAEKATR LHIIDFGISY GFQWPCFIQR LSKRPGGPPN IRMTAIELPQ  480
PGFRPTERVE ETGRRLDKYA KRFNVPFQYK VIAQKWETIQ FEDLKIDRDE LIVVNCMHRL  540
KHIPDETVMA SSPRDTVLKL IKRINPDLYI HGVINGAYNS PFFLTRFREA LFHFSAQFDM  600
FEATIPREDE QRLMFEKAVF GKDIMNVIAC EGLERVERPE TYKQWQVRYQ RAGFKQLPLD  660
QELLKKVKTM LKVMGYHNDF RIDEDGHWML QGWKGRIIMG LAFWKPA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A8e-463377058375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008222405.10.0PREDICTED: LOW QUALITY PROTEIN: scarecrow-like protein 30
SwissprotQ9XE580.0SCL14_ARATH; Scarecrow-like protein 14
TrEMBLM5WJW80.0M5WJW8_PRUPE; Uncharacterized protein
STRINGPOPTR_0009s03850.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF13134339
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07530.10.0SCARECROW-like 14