PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_008222397.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family GRAS
Protein Properties Length: 684aa    MW: 77078.8 Da    PI: 5.8548
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_008222397.1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS376.43.5e-1153116802372
            GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshl 96 
                      +lL+ecA+av s d++ a++lL+++++++sp+g ++qRla+yf+e+L+arla+  s  y  l   +t   +++e l+a+++++ ++P+ k+ h+
  XP_008222397.1 311 CKLLTECAQAVGSYDQQSASELLKQIRQHSSPYGYATQRLAHYFAEGLEARLAGARSLSYPPLLFMHT---STTEILKAYQVYVSACPFKKMLHF 402
                     589***************************************************66555655555555...59********************** PP

            GRAS  97 taNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakrledl 189
                      aN++I++ +e+++r+HiiDf+is+GlQWp+L+q+L+++++gpp+lRiT+++ p++g   +e++eetg+rLak+ e+ gvpfe+nv +ak++e++
  XP_008222397.1 403 FANRTIMKQTEKATRLHIIDFGISYGLQWPCLIQSLSEKTGGPPNLRITAIELPQPGfrPAERIEETGRRLAKYSERYGVPFEYNV-IAKKWETI 496
                     ********************************************************9****************************9.7******* PP

            GRAS 190 eleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerik 284
                      leeL+++++E+++Vn++++l++++de+v ++++rd+vL+l+k+++P+++ +   +  +n++ F++rf + l ++ alfd++ea++pr++e+r  
  XP_008222397.1 497 GLEELQIDRNEVIVVNCMHRLKQIPDETVMMNNPRDAVLNLIKRINPDLFMHGVVNGTYNAPAFVTRFKQLLFHFHALFDMYEATVPRDDEHRLL 591
                     *********************************************************************************************** PP

            GRAS 285 vErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvk.sdgyrveeesgslvlgWkdrpLvsvSa 372
                      Er+++gr+i+nv+aceg er+er et+++W++r  +aGF+++pl+ +  k++k++ ++++  + + +e++ +++++gWk+r ++++Sa
  XP_008222397.1 592 FERAIFGRDIKNVIACEGLERVERPETYKQWQARYVRAGFEQLPLDRELFKKVKTMSKMMGyHKDFGIEDDGEWMLQGWKGRIILALSA 680
                     ************************************************************99999**********************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098565284661IPR005202Transcription factor GRAS
PfamPF035141.2E-112311680IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 684 aa     Download sequence    Send to blast
MEELNFVHGS NSVASDQNLV NGLQVNHEPT NKLLLPANLD RPSDSGTSSE GDTVESSDCN  60
LPVLKYISDI LLEEDLEGKP CMLEDILGLQ AAEKSFYDAL NQKDPPLPNQ PSFSVYQSFE  120
NSDGGFQSSN GSIAAKTGSV WDFSETSHVQ TSPVESLSDT TLVSDSFSDT QSLGNFRGVG  180
EGNEIIDLEG YQCTPPGPNT LYRNLASVPE NYAYNSTNGS KGKKNHQREE GHYTEEGRSN  240
KQSAAFADDS DLQEMFDKVL QGVNPESESC FHDESLNAEG TRKLQHNKQS KGSKTKCLKK  300
PNSNRQVVDL CKLLTECAQA VGSYDQQSAS ELLKQIRQHS SPYGYATQRL AHYFAEGLEA  360
RLAGARSLSY PPLLFMHTST TEILKAYQVY VSACPFKKML HFFANRTIMK QTEKATRLHI  420
IDFGISYGLQ WPCLIQSLSE KTGGPPNLRI TAIELPQPGF RPAERIEETG RRLAKYSERY  480
GVPFEYNVIA KKWETIGLEE LQIDRNEVIV VNCMHRLKQI PDETVMMNNP RDAVLNLIKR  540
INPDLFMHGV VNGTYNAPAF VTRFKQLLFH FHALFDMYEA TVPRDDEHRL LFERAIFGRD  600
IKNVIACEGL ERVERPETYK QWQARYVRAG FEQLPLDREL FKKVKTMSKM MGYHKDFGIE  660
DDGEWMLQGW KGRIILALSA LKPA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A1e-443146828375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008222397.10.0PREDICTED: scarecrow-like protein 14
TrEMBLM5W7A20.0M5W7A2_PRUPE; Uncharacterized protein
STRINGPOPTR_0009s03850.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF13134339
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G29060.10.0GRAS family protein