PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_008222011.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family GRAS
Protein Properties Length: 515aa    MW: 57442.4 Da    PI: 6.3075
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_008222011.1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS365.38.3e-1121465151374
            GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlar.svselykalppsetseknsseelaalklfsevsPilkfs 94 
                     lv++L++cAeav+ +d++ a++lL +l+ +a   g+++qR+a++f+++L+ rla  +  + +  + p ++s+  s+e+  al+l +e++P ++f+
  XP_008222011.1 146 LVQQLIACAEAVACRDKAHASTLLYELRANAKVFGTSFQRVASCFVQGLSDRLALvQPLGAVGVIGPITKSTAFSAERDEALHLVYEICPQIQFG 240
                     689***************************************************933334455556666665669******************** PP

            GRAS  95 hltaNqaIleavegeervHiiDfdis....qGlQWpaLlqaLasRp.egppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlvak 184
                     h++aN  Ilea+ege+ vH+iD++++    +G QW +L+++La+R+ ++ ++lRiTg g+    s+e+l+++g+ L+  A++++++fef++ v++
  XP_008222011.1 241 HFVANASILEAFEGESSVHVIDLGMTlglpHGYQWRNLIDSLANRAgQPLHRLRITGAGN----SAERLQAIGNDLKLHAQSMKLNFEFSA-VES 330
                     **********************98763344788*************455569********....9**************************.799 PP

            GRAS 185 rledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpres 279
                     ++e+l+++++++  gE+l++n++lqlh l++es    +   +vL+++ +lsPk++++veq+++hn++ Fl rf+eal+ ysa+fdsl+a lp+ +
  XP_008222011.1 331 SFENLKPQDFDLVDGEVLVINSILQLHCLVKESRGALN---SVLQTLHQLSPKLMILVEQDTSHNGPFFLGRFMEALHNYSAIFDSLDAMLPKYD 422
                     ******************************88877777...8***************************************************** PP

            GRAS 280 eerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                       r+k+E++++g+ei+n+v+ceg +r+erhe++e+Wr+r+++aGF+p+pl+    +qa   l+    +gy+v e++g+lvlgWk++p++++S+W+
  XP_008222011.1 423 TRRAKMEQFYFGEEIKNIVSCEGPARVERHERVEQWRRRMRRAGFQPAPLKMI--AQAMKWLEINTCEGYTVVEDKGCLVLGWKSKPIIATSCWK 515
                     **************************************************865..5777777777778**************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098557.015120497IPR005202Transcription factor GRAS
PfamPF035142.9E-109146515IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 515 aa     Download sequence    Send to blast
MASGLYVQSE FYGENTSDEV IGLGLNLSSM ACLPYPSSLS TLEENPAGWV IPFIDETTSH  60
KRLKQQHSAS YEFNNAGTNY YSLYIGSGSM CARGLDSLPR IHFRDHISAY TRRYLALEAM  120
EEATATLMRG KEGESEEEGR GDETKLVQQL IACAEAVACR DKAHASTLLY ELRANAKVFG  180
TSFQRVASCF VQGLSDRLAL VQPLGAVGVI GPITKSTAFS AERDEALHLV YEICPQIQFG  240
HFVANASILE AFEGESSVHV IDLGMTLGLP HGYQWRNLID SLANRAGQPL HRLRITGAGN  300
SAERLQAIGN DLKLHAQSMK LNFEFSAVES SFENLKPQDF DLVDGEVLVI NSILQLHCLV  360
KESRGALNSV LQTLHQLSPK LMILVEQDTS HNGPFFLGRF MEALHNYSAI FDSLDAMLPK  420
YDTRRAKMEQ FYFGEEIKNI VSCEGPARVE RHERVEQWRR RMRRAGFQPA PLKMIAQAMK  480
WLEINTCEGY TVVEDKGCLV LGWKSKPIIA TSCWK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A3e-461465154375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008222011.10.0PREDICTED: DELLA protein RGL1-like
TrEMBLM5XQZ90.0M5XQZ9_PRUPE; Uncharacterized protein
STRINGPOPTR_0015s10310.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF87302945
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G66350.16e-65RGA-like 1