PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_008221422.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family GRAS
Protein Properties Length: 633aa    MW: 69969.9 Da    PI: 5.3245
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_008221422.1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS455.63.1e-1392656241374
            GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfsh 95 
                     lv+ L++cAeav++++l+la+al++++  la +++ +m+++a+yf+eALa+r++r    +y    p++    ++s + + +  f+e++P+lkf+h
  XP_008221422.1 265 LVHGLMACAEAVQQNNLNLAKALVTQIGYLAISQAGAMRKVATYFAEALAQRIFR----VY----PQSPI--DHSFSDMLQMHFYETCPYLKFAH 349
                     6899***************************************************....44....33333..23444444556************ PP

            GRAS  96 ltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlvakrledle 190
                     +taNqaIlea++g++rvH+iDf+++qG+QWpaL+qaLa Rp+gpp +R+Tg+g+p+s++++ l+e+g++La++Ae+++v+fe++ +va++l+dl+
  XP_008221422.1 350 FTANQAILEALQGKTRVHVIDFSMNQGMQWPALMQALALRPGGPPAFRLTGIGPPASDNSDHLQEVGWKLAQLAETIHVEFEYRGFVANSLADLD 444
                     *********************************************************************************************** PP

            GRAS 191 leeLrvkp..gEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseeri 283
                      ++L+++p   E++aVn+v++lh+ll++++++e+    vL++vk+++P++v+vveqea+hn++ F++rf e+l+yys+lfdsle ++   +++++
  XP_008221422.1 445 ASMLELRPseVESVAVNSVFELHKLLARPGAIEK----VLSVVKQMKPEIVTVVEQEANHNGPVFMDRFNESLHYYSTLFDSLEGSV---NSQDK 532
                     ********88899*********************....************************************************7...88889 PP

            GRAS 284 kvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvk.sdgyrveeesgslvlgWkdrpLvsvSaWr 374
                      +++ +lg++i+nvvaceg +r+erhetl +Wr rl++aGF pv+l+++a kqa++ll+ ++ +dgyrvee++g+l+lgW++rpL+++SaW+
  XP_008221422.1 533 AMSELYLGKQICNVVACEGVDRVERHETLTQWRTRLDSAGFVPVHLGSNAFKQASMLLALFAgGDGYRVEENNGCLMLGWHTRPLIATSAWK 624
                     999999*************************************************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011292.5E-3747120No hitNo description
PfamPF120412.0E-3647114IPR021914Transcriptional factor DELLA, N-terminal
PROSITE profilePS5098567.47239603IPR005202Transcription factor GRAS
PfamPF035141.1E-136265624IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009723Biological Processresponse to ethylene
GO:0009737Biological Processresponse to abscisic acid
GO:0009867Biological Processjasmonic acid mediated signaling pathway
GO:0009938Biological Processnegative regulation of gibberellic acid mediated signaling pathway
GO:0010187Biological Processnegative regulation of seed germination
GO:0010218Biological Processresponse to far red light
GO:0042176Biological Processregulation of protein catabolic process
GO:0042538Biological Processhyperosmotic salinity response
GO:2000033Biological Processregulation of seed dormancy process
GO:2000377Biological Processregulation of reactive oxygen species metabolic process
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 633 aa     Download sequence    Send to blast
MKREHQIYHQ YPYPDPSSMA STSAGDCGKA SNKMWEEDAQ RIDGGMDELL AVLGYKVRSS  60
DMAEVAQKLE QLEEFMGSVQ EDGLSQLASD TVHYNPSDLS TWLESMISEI NPPPNFDPLM  120
AVAAVPLPNQ QQQVQLGDDS FLAPAESSTI TSIDFRDQQV SKSLSPPPPQ TQNHHPHHQV  180
VFDDCNSSSN YYDLKATMFT QTHHDSSSRE AKRLKPSSGS SASDLVFNRR TASSLPQPQP  240
LSIPTTESST RPALLVDSQE NGVRLVHGLM ACAEAVQQNN LNLAKALVTQ IGYLAISQAG  300
AMRKVATYFA EALAQRIFRV YPQSPIDHSF SDMLQMHFYE TCPYLKFAHF TANQAILEAL  360
QGKTRVHVID FSMNQGMQWP ALMQALALRP GGPPAFRLTG IGPPASDNSD HLQEVGWKLA  420
QLAETIHVEF EYRGFVANSL ADLDASMLEL RPSEVESVAV NSVFELHKLL ARPGAIEKVL  480
SVVKQMKPEI VTVVEQEANH NGPVFMDRFN ESLHYYSTLF DSLEGSVNSQ DKAMSELYLG  540
KQICNVVACE GVDRVERHET LTQWRTRLDS AGFVPVHLGS NAFKQASMLL ALFAGGDGYR  600
VEENNGCLML GWHTRPLIAT SAWKPGCDSV MAH
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A1e-532656244375GRAS family transcription factor containing p
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00611ChIP-seqTransfer from AT2G01570Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008221422.10.0PREDICTED: DELLA protein GAIP-B
SwissprotQ6EI050.0GAIPB_CUCMA; DELLA protein GAIP-B
TrEMBLI1ZG120.0I1ZG12_9R
STRINGPOPTR_0008s13090.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF80334121
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G14920.10.0GRAS family protein