PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_008220696.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family ARR-B
Protein Properties Length: 662aa    MW: 73111.1 Da    PI: 6.5123
Description ARR-B family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_008220696.1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like89.23.7e-28205258155
         G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                     kpr++W+ eLH++Fv av+qL G++kA+Pk+il+lm+v+ Lt+e+v+SHLQkYRl
  XP_008220696.1 205 KPRVVWSLELHRKFVAAVNQL-GIDKAVPKKILDLMNVEKLTRENVASHLQKYRL 258
                     79*******************.********************************8 PP

2Response_reg783.4e-26201281109
                     EEEESSSHHHHHHHHHHHHHTTCEEEEEESSHHHHHHHHHHHH..ESEEEEESSCTTSEHHHHHHHHHHHTTTSEEEEEESTTTHHHHHHHHHTT CS
    Response_reg   1 vlivdDeplvrellrqalekegyeevaeaddgeealellkekd..pDlillDiempgmdGlellkeireeepklpiivvtahgeeedalealkaG 93 
                     vl vdD+p+ ++ll  +l++ +y +v++++++  al+ll+e++  +Dl++ D+ mp+mdG++ll+     e++lp+i+++a+g+ +++ + +  G
  XP_008220696.1  20 VLAVDDDPICLKLLDALLRRCKY-HVTTTSQAITALKLLRENKnkFDLVISDVHMPDMDGFKLLELVGL-EMDLPVIMLSANGDTKLVMKGITHG 112
                     799********************.***************888888*******************87754.558********************** PP

                     ESEEEESS--HHHHHH CS
    Response_reg  94 akdflsKpfdpeelvk 109
                     a d+l Kp+ +e+l +
  XP_008220696.1 113 ACDYLLKPVRIEQLKN 128
                     *************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0363924.4E-1691662IPR017053Response regulator B-type, plant
SuperFamilySSF521723.98E-3517141IPR011006CheY-like superfamily
Gene3DG3DSA:3.40.50.23008.0E-4217151No hitNo description
SMARTSM004484.9E-3118130IPR001789Signal transduction response regulator, receiver domain
PROSITE profilePS5011042.15119134IPR001789Signal transduction response regulator, receiver domain
PfamPF000721.9E-2320128IPR001789Signal transduction response regulator, receiver domain
CDDcd001564.04E-2721134No hitNo description
Gene3DG3DSA:1.10.10.605.3E-30202263IPR009057Homeodomain-like
PROSITE profilePS5129411.539202261IPR017930Myb domain
SuperFamilySSF466891.61E-19203262IPR009057Homeodomain-like
TIGRFAMsTIGR015576.3E-25205258IPR006447Myb domain, plants
PfamPF002491.4E-6207257IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000160Biological Processphosphorelay signal transduction system
GO:0009414Biological Processresponse to water deprivation
GO:0010082Biological Processregulation of root meristem growth
GO:0010380Biological Processregulation of chlorophyll biosynthetic process
GO:0031537Biological Processregulation of anthocyanin metabolic process
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0048367Biological Processshoot system development
GO:0080022Biological Processprimary root development
GO:0080036Biological Processregulation of cytokinin-activated signaling pathway
GO:0080113Biological Processregulation of seed growth
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 662 aa     Download sequence    Send to blast
MTVEGVLDEP RDQFPIGMRV LAVDDDPICL KLLDALLRRC KYHVTTTSQA ITALKLLREN  60
KNKFDLVISD VHMPDMDGFK LLELVGLEMD LPVIMLSANG DTKLVMKGIT HGACDYLLKP  120
VRIEQLKNIW QHVIRRKKVD SKDQNSCNQE KSHVGNGEGG PGSVGTGNSD QNAKLNKKRK  180
DQDEDEDDDR DEDGHDNDDP SAQKKPRVVW SLELHRKFVA AVNQLGIDKA VPKKILDLMN  240
VEKLTRENVA SHLQKYRLYL KRISRVANQQ ANMVAALGTS DSSYLRMTSV NGVGNFHPLT  300
GPGQFHNNAF RSFPPSGMVG RLNTPAGLGL HCLPSSGMFQ LSHAQNPSNS INDQPLIFPG  360
NRNGNILPAP LELDQQHGTE AACVADFSAA ANGTTVYPTS SGLPDAKVFN SSNDALGLAD  420
NPILRHTQDS EVGRNYVNQS SVSRASLRSE LSPPFLDHGR LNDNWSSASQ PSMFCSNSFS  480
SRDSFKQPTL LQSNLKDNMP VMSSQIGSSQ IDVSISCQSQ DSRFGLPIQA SAMSNNSGQT  540
INNIPFQGWD DHKPDSQYPS DVMCTSMNSL MPVNDTVAPF DQNSDSRRTT FQRNMGFNSI  600
GQSNFLDPLL MKYDDVELTQ DASLKMRPGY LMDQRKLQGG YNPNNVGSLD ELVSAMMKQE  660
RR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A1e-26201264164ARR10-B
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1256265RLYLKRISRV
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_008220696.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008220696.10.0PREDICTED: two-component response regulator ARR12-like
TrEMBLA0A251RA030.0A0A251RA03_PRUPE; Two-component response regulator
STRINGXP_008220696.10.0(Prunus mume)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF95634112
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G25180.11e-132response regulator 12