PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_008220424.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family HD-ZIP
Protein Properties Length: 316aa    MW: 35777.8 Da    PI: 6.7159
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_008220424.1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox597.6e-19159213256
                     T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
        Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                     rk+ +++keq  +Le+ F+++ +++ +++++LA+kl+L  rqV vWFqNrRa+ k
  XP_008220424.1 159 RKKLRLSKEQSATLEDSFREHTTLNPKQKQDLARKLNLRPRQVEVWFQNRRARTK 213
                     788899***********************************************98 PP

2HD-ZIP_I/II1201.3e-38159246188
     HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLr 88 
                     +kk+rlskeq+++LE+sF+e+++L+p++K++lar+L+l+prqv+vWFqnrRARtk+kq+E d+e Lk+++++lkeen+rL+ke +e++
  XP_008220424.1 159 RKKLRLSKEQSATLEDSFREHTTLNPKQKQDLARKLNLRPRQVEVWFQNRRARTKLKQTEADCELLKKCCETLKEENRRLHKELQEVK 246
                     69**********************************************************************************9987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466896.27E-18149216IPR009057Homeodomain-like
PROSITE profilePS5007117.427155215IPR001356Homeobox domain
SMARTSM003891.1E-16157219IPR001356Homeobox domain
CDDcd000863.58E-16158216No hitNo description
Gene3DG3DSA:1.10.10.602.5E-17159213IPR009057Homeodomain-like
PfamPF000462.9E-16159213IPR001356Homeobox domain
PROSITE patternPS000270190213IPR017970Homeobox, conserved site
PfamPF021837.7E-8215248IPR003106Leucine zipper, homeobox-associated
SMARTSM003402.8E-16215258IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 316 aa     Download sequence    Send to blast
MSFDEACNTG LGLSLGCRDS VDHDHTNLQA PPDHHHHHHH HHHHQNTYRN KQIQLKYDHL  60
LPSLTLGPSA ASKIEEAEST DLHQAVAVQE QASSPCSGAF SSFSNSSSFK RDRELGGEEI  120
EVEVEVEVEV EVEEERVVNI TSSRASEELY EQDHEGSPRK KLRLSKEQSA TLEDSFREHT  180
TLNPKQKQDL ARKLNLRPRQ VEVWFQNRRA RTKLKQTEAD CELLKKCCET LKEENRRLHK  240
ELQEVKLMKQ TATAAAPPFY MQFPTATLTM CPSCEKICNG GDHHNHHGSS TSSFLIGSKP  300
AHLIFNPFST HPSTAC
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1207215RRARTKLKQ
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_008220424.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008220424.10.0PREDICTED: homeobox-leucine zipper protein HAT22-like
TrEMBLA0A314YD960.0A0A314YD96_PRUYE; Homeobox-leucine zipper protein HAT22-like
STRINGXP_008220424.10.0(Prunus mume)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF114433107
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37790.12e-64HD-ZIP family protein