PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_008219303.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family M-type_MADS
Protein Properties Length: 229aa    MW: 26480.7 Da    PI: 9.9042
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_008219303.1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF59.15.4e-191151343
                    --SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TT CS
          SRF-TF  3 ienksnrqvtfskRrngilKKAeELSvLCdaevaviifsst 43
                    i+n+s r+ tf kR++g++KK +ELS+LCd+e++ ii+s+ 
  XP_008219303.1 11 ISNDSARKATFKKRKKGLMKKVSELSTLCDVEACAIIYSPY 51
                    9**************************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006618.306149IPR002100Transcription factor, MADS-box
SMARTSM004323.0E-25160IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.07E-25395IPR002100Transcription factor, MADS-box
CDDcd002661.65E-21385No hitNo description
PRINTSPR004041.8E-11323IPR002100Transcription factor, MADS-box
PfamPF003193.0E-191151IPR002100Transcription factor, MADS-box
PRINTSPR004041.8E-112338IPR002100Transcription factor, MADS-box
PRINTSPR004041.8E-113859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 229 aa     Download sequence    Send to blast
MSRKKVKLTY ISNDSARKAT FKKRKKGLMK KVSELSTLCD VEACAIIYSP YDTQPEIWPS  60
PLGVQRVLAK FKTMPEMEQS KKMVNQESFL RQRIEKAKEQ LKKQRKDNRE KEMTRVMFQS  120
LTGKPLQGLS MIDLNDLGWL IDQNLKEIHN KIKSLNEEAE KKQVQLEPTG LPVHATAADQ  180
GIMERQPWFT DMMNPQEQHM GLGAGEEMML PFGDQNHINA IWSNNAFFH
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1224RKKVKLTYISNDSARKATFKKRK
22125KKRKK
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. Controls central cell differentiation during female gametophyte development. Required for the expression of DEMETER and DD46, but not for the expression of FIS2 (PubMed:16798889). Probable transcription factor that may function in the maintenance of the proper function of the central cell in pollen tube attraction (Probable). {ECO:0000269|PubMed:16798889, ECO:0000305|PubMed:26462908}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_008219303.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKP3475500.0KP347550.1 Prunus pseudocerasus Agamous-like protein mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008219303.11e-172PREDICTED: agamous-like MADS-box protein AGL80
SwissprotQ9FJK33e-63AGL80_ARATH; Agamous-like MADS-box protein AGL80
TrEMBLA0A314UMV21e-168A0A314UMV2_PRUYE; Agamous-like MADS-box protein AGL80
STRINGXP_008219303.11e-171(Prunus mume)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF45233154
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G48670.11e-65AGAMOUS-like 80
Publications ? help Back to Top
  1. Zhang S, et al.
    FERTILIZATION-INDEPENDENT SEED-Polycomb Repressive Complex 2 Plays a Dual Role in Regulating Type I MADS-Box Genes in Early Endosperm Development.
    Plant Physiol., 2018. 177(1): p. 285-299
    [PMID:29523711]