PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PSME_00057188-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Pseudotsuga
Family M-type_MADS
Protein Properties Length: 66aa    MW: 7417.66 Da    PI: 10.682
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PSME_00057188-RAgenomePRSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF96.79.9e-31250351
                      --SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
            SRF-TF  3 ienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                      ien++nrqvtfskRr g+lKKA+ELS+LC+aeva+iifsstgkl+e+ss
  PSME_00057188-RA  2 IENTTNRQVTFSKRRGGLLKKAKELSILCNAEVALIIFSSTGKLHEWSS 50
                      9**********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004322.5E-27151IPR002100Transcription factor, MADS-box
PROSITE profilePS5006626.506152IPR002100Transcription factor, MADS-box
SuperFamilySSF554557.19E-27260IPR002100Transcription factor, MADS-box
PfamPF003198.1E-27248IPR002100Transcription factor, MADS-box
PRINTSPR004042.6E-161429IPR002100Transcription factor, MADS-box
PRINTSPR004042.6E-162950IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 66 aa     Download sequence    Send to blast
MIENTTNRQV TFSKRRGGLL KKAKELSILC NAEVALIIFS STGKLHEWSS SRLVSLANFY  60
FVTTIP
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional factor that targets the CArG motif 5'-C(A/T)TTAAAAAG-3' in the promoter of D14. Directly suppresses D14 expression to control the outgrowth of axillary buds. {ECO:0000269|PubMed:23463009}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF1200976e-50AF120097.1 Pinus radiata DEF/GLO-like protein (PrDGL) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020180450.11e-23MADS-box transcription factor 57-like
RefseqXP_020180451.11e-23MADS-box transcription factor 57-like
SwissprotQ6Z6W22e-21MAD57_ORYSJ; MADS-box transcription factor 57
TrEMBLA0A455R1Q05e-26A0A455R1Q0_9SPER; GLOBOSA/PISTILLATA-like MADS-box protein
STRINGTraes_6AL_B5D4C3A49.11e-24(Triticum aestivum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G51870.26e-24AGAMOUS-like 71
Publications ? help Back to Top
  1. Guo S, et al.
    The interaction between OsMADS57 and OsTB1 modulates rice tillering via DWARF14.
    Nat Commun, 2013. 4: p. 1566
    [PMID:23463009]
  2. Puig J, et al.
    Analysis of the expression of the AGL17-like clade of MADS-box transcription factors in rice.
    Gene Expr. Patterns, 2013 Jun-Jul. 13(5-6): p. 160-70
    [PMID:23466806]
  3. Yu C, et al.
    The effects of fluctuations in the nutrient supply on the expression of five members of the AGL17 clade of MADS-box genes in rice.
    PLoS ONE, 2014. 9(8): p. e105597
    [PMID:25140876]
  4. Wang H, et al.
    A Signaling Cascade from miR444 to RDR1 in Rice Antiviral RNA Silencing Pathway.
    Plant Physiol., 2016. 170(4): p. 2365-77
    [PMID:26858364]