PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PSME_00055109-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Pseudotsuga
Family HB-other
Protein Properties Length: 80aa    MW: 9135.35 Da    PI: 8.502
Description HB-other family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PSME_00055109-RAgenomePRSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox20.11.1e-064680539
                      SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS CS
          Homeobox  5 ttftkeqleeLeelFeknrypsaeereeLAkklgL 39
                      ++++ +q++ Le  Fe +r++  e++ +L+++lgL
  PSME_00055109-RA 46 RRMSVQQVRSLEMSFETKRKIEPERKMQLTAELGL 80
                      57999****************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.604.5E-63380IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 80 aa     Download sequence    Send to blast
MIVNGHRLGS RSWFYGSVLY DNLSSSKEVG LCDDEETSGG IHSKNRRMSV QQVRSLEMSF  60
ETKRKIEPER KMQLTAELGL
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA9NYL74e-32A9NYL7_PICSI; Uncharacterized protein
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G15150.12e-10homeobox 3