PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PSME_00054766-RA
Common NameC3HDZ2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Pseudotsuga
Family HB-other
Protein Properties Length: 122aa    MW: 14592.9 Da    PI: 10.1098
Description HB-other family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PSME_00054766-RAgenomePRSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox51.91.3e-161775357
                      --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
          Homeobox  3 kRttftkeqleeLeelFeknrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57
                      k  ++t+eq+e+Le+l++ +++p   +r++  +++    +++ +q+kvWFqNrR +ek+
  PSME_00054766-RA 17 KYVRYTAEQVEALERLYNDCPKPISLRRQQHIRECpilsHIEPKQIKVWFQNRRCREKQ 75
                      5678*****************************************************97 PP

2bZIP_123.61.1e-07691121861
                       HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
            bZIP_1  18 rrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklks 61 
                       rr+R++  +e  +L++   +L+a Nk L +e+++l+k+v++l  
  PSME_00054766-RA  69 RRCREKQHKEASRLQTVNMKLTAMNKLLMEENDRLQKQVSQLVY 112
                       9***************************************9965 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007113.3781276IPR001356Homeobox domain
SMARTSM003893.1E-91480IPR001356Homeobox domain
CDDcd000863.97E-91777No hitNo description
SuperFamilySSF466893.29E-131779IPR009057Homeodomain-like
PfamPF000467.8E-141875IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.604.5E-161972IPR009057Homeodomain-like
Gene3DG3DSA:1.20.5.1703.4E-473110No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 122 aa     Download sequence    Send to blast
MTVTVVTAQS RAMEAGKYVR YTAEQVEALE RLYNDCPKPI SLRRQQHIRE CPILSHIEPK  60
QIKVWFQNRR CREKQHKEAS RLQTVNMKLT AMNKLLMEEN DRLQKQVSQL VYENGYFRQQ  120
IQ
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in the regulation of vascular development. May promote differentiation of precambial and cambial cells. {ECO:0000269|PubMed:11402194, ECO:0000269|PubMed:15598805}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By auxin. Repressed by miR165. {ECO:0000269|PubMed:17237362, ECO:0000269|PubMed:8575317}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankDQ3855290.0DQ385529.1 Pseudotsuga menziesii class III homeodomain-leucine zipper protein C3HDZ2 (C3HDZ2) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009378434.12e-66PREDICTED: homeobox-leucine zipper protein ATHB-15-like, partial
SwissprotQ391234e-62ATHB8_ARATH; Homeobox-leucine zipper protein ATHB-8
TrEMBLQ20BK61e-73Q20BK6_PSEMZ; Class III homeodomain-leucine zipper protein C3HDZ2
STRINGXP_009378434.17e-66(Pyrus x bretschneideri)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G32880.12e-64homeobox gene 8
Publications ? help Back to Top
  1. Floyd SK,Zalewski CS,Bowman JL
    Evolution of class III homeodomain-leucine zipper genes in streptophytes.
    Genetics, 2006. 173(1): p. 373-88
    [PMID:16489224]
  2. Heyndrickx KS,Vandepoele K
    Systematic identification of functional plant modules through the integration of complementary data sources.
    Plant Physiol., 2012. 159(3): p. 884-901
    [PMID:22589469]
  3. Hategan L,Godza B,Kozma-Bognar L,Bishop GJ,Szekeres M
    Differential expression of the brassinosteroid receptor-encoding BRI1 gene in Arabidopsis.
    Planta, 2014. 239(5): p. 989-1001
    [PMID:24488524]
  4. Baima S, et al.
    Negative feedback regulation of auxin signaling by ATHB8/ACL5-BUD2 transcription module.
    Mol Plant, 2014. 7(6): p. 1006-1025
    [PMID:24777988]
  5. Kakehi J, et al.
    Mutations in ribosomal proteins, RPL4 and RACK1, suppress the phenotype of a thermospermine-deficient mutant of Arabidopsis thaliana.
    PLoS ONE, 2015. 10(1): p. e0117309
    [PMID:25625317]
  6. Jia X, et al.
    Functional plasticity of miR165/166 in plant development revealed by small tandem target mimic.
    Plant Sci., 2015. 233: p. 11-21
    [PMID:25711809]
  7. Liu S, et al.
    Expression of wild-type PtrIAA14.1, a poplar Aux/IAA gene causes morphological changes in Arabidopsis.
    Front Plant Sci, 2015. 6: p. 388
    [PMID:26082787]
  8. Yamaguchi YL, et al.
    Root-Knot and Cyst Nematodes Activate Procambium-Associated Genes in Arabidopsis Roots.
    Front Plant Sci, 2017. 8: p. 1195
    [PMID:28747918]
  9. Yamazaki K, et al.
    Suppression of DELLA signaling induces procambial cell formation in culture.
    Plant J., 2018. 94(1): p. 48-59
    [PMID:29383774]