PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PSME_00053030-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Pseudotsuga
Family M-type_MADS
Protein Properties Length: 104aa    MW: 12005.9 Da    PI: 10.6256
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PSME_00053030-RAgenomePRSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF823.8e-261059251
                      ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
            SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                       i n s r+ tf kR+ g+lKKA+ELSvLCdaeva+iifs+tgk+ye++s
  PSME_00053030-RA 10 LIRNPSSRHATFYKRKSGLLKKAFELSVLCDAEVALIIFSETGKIYEFAS 59
                      699*********************************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004322.9E-32160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006628.371161IPR002100Transcription factor, MADS-box
SuperFamilySSF554554.45E-29285IPR002100Transcription factor, MADS-box
PRINTSPR004045.5E-25323IPR002100Transcription factor, MADS-box
PfamPF003199.2E-241157IPR002100Transcription factor, MADS-box
PRINTSPR004045.5E-252338IPR002100Transcription factor, MADS-box
PRINTSPR004045.5E-253859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 104 aa     Download sequence    Send to blast
MGKKKLELKL IRNPSSRHAT FYKRKSGLLK KAFELSVLCD AEVALIIFSE TGKIYEFASQ  60
NDITRILAKY KERARNATPT SLQNTEEENS KLSSKWHWIR SKTS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5f28_A4e-21172171MEF2C
5f28_B4e-21172171MEF2C
5f28_C4e-21172171MEF2C
5f28_D4e-21172171MEF2C
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. May be involved in the control of flowering time. {ECO:0000269|PubMed:9339904, ECO:0000269|Ref.9}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEF0876272e-75EF087627.1 Picea sitchensis clone WS02731_B04 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_028959657.19e-27MADS-box transcription factor 23-like isoform X4
SwissprotQ9SAR19e-27MADS8_ORYSJ; MADS-box transcription factor 8
TrEMBLA9P1V38e-42A9P1V3_PICSI; Uncharacterized protein
STRINGMLOC_56472.22e-26(Hordeum vulgare)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G24260.36e-27MIKC_MADS family protein
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]
  2. Jang YH, et al.
    Survey of rice proteins interacting with OsFCA and OsFY proteins which are homologous to the Arabidopsis flowering time proteins, FCA and FY.
    Plant Cell Physiol., 2009. 50(8): p. 1479-92
    [PMID:19561057]
  3. Cui R, et al.
    Functional conservation and diversification of class E floral homeotic genes in rice (Oryza sativa).
    Plant J., 2010. 61(5): p. 767-81
    [PMID:20003164]
  4. Bai X, et al.
    Regulatory role of FZP in the determination of panicle branching and spikelet formation in rice.
    Sci Rep, 2016. 6: p. 19022
    [PMID:26744119]