PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PSME_00052905-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Pseudotsuga
Family VOZ
Protein Properties Length: 320aa    MW: 35867.3 Da    PI: 5.352
Description VOZ family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PSME_00052905-RAgenomePRSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1VOZ139.42.8e-4375166192
               VOZ   1 pppsaflgpkcalwdctrpaqgsewlqdycssfhatlalneglpgttpvlrpkgidlkdgllfaalsakvqgkevgipecegaatakspwna 92 
                       ppp aflgpkcalwdc+rpaqgs w+qdyc +fh+++alneg+pg+  vlrp+gidlkd+llfa+l ak+     gip+cegaa +kspwna
  PSME_00052905-RA  75 PPPNAFLGPKCALWDCPRPAQGSYWCQDYCINFHEMVALNEGPPGMGSVLRPGGIDLKDALLFASLGAKTVVNFFGIPKCEGAAPKKSPWNA 166
                       89*****************************************************************************************9 PP

2VOZ122.24.9e-38168244131207
               VOZ 131 dysgrgwhesrkqvmkefgglkrsyymdpqpsssfewhlyeyeineldalalyrlelklvdekksakgkvskdslad 207
                       dy+grgwhe rkqvmke gg+krsyymd  ps++fewhlyeye n++d++alyrlelk+vd+kk++k+kv+ d ++ 
  PSME_00052905-RA 168 DYNGRGWHEPRKQVMKEIGGMKRSYYMDRHPSNQFEWHLYEYEKNNCDSCALYRLELKHVDSKKNTKAKVMGDYVNT 244
                       9**********************************************************************998875 PP

Sequence ? help Back to Top
Protein Sequence    Length: 320 aa     Download sequence    Send to blast
GFYVDHANAE AQNIDGTSRS ENIHTESLLQ NTDESLEAAT QMNQDFDHNI CLSLDPEVEE  60
EHIPKFQGPC PGISPPPNAF LGPKCALWDC PRPAQGSYWC QDYCINFHEM VALNEGPPGM  120
GSVLRPGGID LKDALLFASL GAKTVVNFFG IPKCEGAAPK KSPWNALDYN GRGWHEPRKQ  180
VMKEIGGMKR SYYMDRHPSN QFEWHLYEYE KNNCDSCALY RLELKHVDSK KNTKAKVMGD  240
YVNTEKDHII CEDSHSKVVV EDAYLEPQNS QTLHLRLVKG NATCGISNDH QQGGPYPDVL  300
APPEHIIPCV EHLKMLADVF
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator acting positively in the phytochrome B signaling pathway. Functions redundantly with VOZ2 to promote flowering downstream of phytochrome B (phyB). Down-regulates 'FLOWERING LOCUS C' (FLC) and up-regulates 'FLOWERING LOCUS T' (FT). Binds to the 38-bp cis-acting region of the AVP1 gene. Interacts with phyB in the cytoplasm and is translocated to the nucleus at signal transmission, where it is subjected to degradation in a phytochrome-dependent manner. {ECO:0000269|PubMed:15295067, ECO:0000269|PubMed:22904146}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By far-red light. {ECO:0000269|PubMed:22904146}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010657013.13e-84PREDICTED: transcription factor VOZ1
RefseqXP_018855072.11e-84PREDICTED: transcription factor VOZ1-like
RefseqXP_019079230.13e-84PREDICTED: transcription factor VOZ1
SwissprotQ9SGQ04e-77VOZ1_ARATH; Transcription factor VOZ1
TrEMBLA0A2I4HG633e-83A0A2I4HG63_JUGRE; transcription factor VOZ1-like
STRINGVIT_12s0028g02670.t014e-83(Vitis vinifera)
STRINGXP_010260370.11e-83(Nelumbo nucifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G28520.22e-79vascular plant one zinc finger protein
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  2. Yasui Y,Kohchi T
    VASCULAR PLANT ONE-ZINC FINGER1 and VOZ2 repress the FLOWERING LOCUS C clade members to control flowering time in Arabidopsis.
    Biosci. Biotechnol. Biochem., 2014. 78(11): p. 1850-5
    [PMID:25351333]
  3. Kumar S,Choudhary P,Gupta M,Nath U
    VASCULAR PLANT ONE-ZINC FINGER1 (VOZ1) and VOZ2 Interact with CONSTANS and Promote Photoperiodic Flowering Transition.
    Plant Physiol., 2018. 176(4): p. 2917-2930
    [PMID:29507119]
  4. Song C,Lee J,Kim T,Hong JC,Lim CO
    VOZ1, a transcriptional repressor of DREB2C, mediates heat stress responses in Arabidopsis.
    Planta, 2018. 247(6): p. 1439-1448
    [PMID:29536220]