PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PSME_00047064-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Pseudotsuga
Family HB-other
Protein Properties Length: 208aa    MW: 23687.3 Da    PI: 5.9884
Description HB-other family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PSME_00047064-RAgenomePRSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox19.81.4e-0668981646
                      HHHHHHSSS--HHHHHHHHHHCTS-HHHHHH CS
          Homeobox 16 eelFeknrypsaeereeLAkklgLterqVkv 46
                      +e+F+++++++ +++  LA++l+L  rqV v
  PSME_00047064-RA 68 KEYFNEHNTLNSKQKLALAEQLNLRPRQVEV 98
                      6899*************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.2E-56899IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 208 aa     Download sequence    Send to blast
MMEPLRWRLS SFQMDFAICN GTCAVKRERD DDHPDNNAND HELDRVFSRA SDEEEDGRTS  60
RKKLHLSKEY FNEHNTLNSK QKLALAEQLN LRPRQVEVYG SITEEPDEAD RSGLLISEEM  120
PRNPYRREQV TAERYSIDEG FESGASKLLH ALACNHSLNM CPSCDRIASV SLPLDNNTKG  180
LHGHGPSPWP TLASAHLHTT RPPPRLEQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA9NV752e-49A9NV75_PICSI; Uncharacterized protein
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06710.14e-16homeobox from Arabidopsis thaliana