PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PSME_00046752-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Pseudotsuga
Family M-type_MADS
Protein Properties Length: 310aa    MW: 35146.6 Da    PI: 6.7973
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PSME_00046752-RAgenomePRSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF50.72.3e-163351850
                      HHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS
            SRF-TF 18 ngilKKAeELSvLCdaevaviifsstgklyeys 50
                      ng+lKK +ELSvLCdaev ++ifs++gklye++
  PSME_00046752-RA  3 NGLLKKTYELSVLCDAEVELMIFSPRGKLYEFA 35
                      8*******************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5023517.11286IPR028889Ubiquitin specific protease domain
PROSITE profilePS5006617.395138IPR002100Transcription factor, MADS-box
SMARTSM004322.3E-6137IPR002100Transcription factor, MADS-box
PfamPF003191.0E-12334IPR002100Transcription factor, MADS-box
SuperFamilySSF554556.41E-13338IPR002100Transcription factor, MADS-box
SuperFamilySSF540016.67E-29134284No hitNo description
PfamPF004433.6E-23193283IPR001394Peptidase C19, ubiquitin carboxyl-terminal hydrolase
PROSITE patternPS009730228245IPR018200Ubiquitin specific protease, conserved site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006511Biological Processubiquitin-dependent protein catabolic process
GO:0016579Biological Processprotein deubiquitination
GO:0003677Molecular FunctionDNA binding
GO:0036459Molecular Functionthiol-dependent ubiquitinyl hydrolase activity
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 310 aa     Download sequence    Send to blast
MMNGLLKKTY ELSVLCDAEV ELMIFSPRGK LYEFANPRYS FPSQCAGLWK PYGTPFLASL  60
RDDIRTGAYI HSIVQTLLGP MLTAKNFSSS DHVKTVKGFG YKLAADQNAK DISKPLISDN  120
GSSDAVLESS SNYADKSIDN GHLQGNLAFQ LWLVDDKSVT KEVSITEDKP ISISNTCTRV  180
QVFIDWSEKE LENRSMKHKL ETFVNFPIHD FDLTRYVARK NGLQRHLYEL YAVSNHYGSM  240
GSGHYTAHVK LIDENRWYNF DDSHVSPISE DEIKTSAAYV FFYRIVKLED GSMSNGAHSY  300
ANHENFGFRK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2y6e_A1e-20193284266356UBIQUITIN CARBOXYL-TERMINAL HYDROLASE 4
2y6e_B1e-20193284266356UBIQUITIN CARBOXYL-TERMINAL HYDROLASE 4
2y6e_C1e-20193284266356UBIQUITIN CARBOXYL-TERMINAL HYDROLASE 4
2y6e_D1e-20193284266356UBIQUITIN CARBOXYL-TERMINAL HYDROLASE 4
2y6e_E1e-20193284266356UBIQUITIN CARBOXYL-TERMINAL HYDROLASE 4
2y6e_F1e-20193284266356UBIQUITIN CARBOXYL-TERMINAL HYDROLASE 4
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT1005721e-127BT100572.1 Picea glauca clone GQ0025_P15 mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010267703.14e-52PREDICTED: ubiquitin carboxyl-terminal hydrolase 5 isoform X2
STRINGXP_010267702.12e-51(Nelumbo nucifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G58780.22e-14MIKC_MADS family protein