PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PSME_00046172-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Pseudotsuga
Family HB-other
Protein Properties Length: 371aa    MW: 42360.2 Da    PI: 7.3606
Description HB-other family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PSME_00046172-RAgenomePRSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox57.13e-181873257
                      T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHHC CS
          Homeobox  2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakekk 57
                      +kR+  t++q+e+Le+ +++++yp+++++++L+++lgL+e+qV+ WF  rR k+kk
  PSME_00046172-RA 18 QKRRLKTPSQVEALENIYAEHKYPTESMKAKLSRELGLSEKQVQRWFRHRRLKDKK 73
                      589999************************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007116.2771474IPR001356Homeobox domain
SMARTSM003891.1E-171778IPR001356Homeobox domain
SuperFamilySSF466893.99E-171776IPR009057Homeodomain-like
CDDcd000861.83E-171875No hitNo description
PfamPF000469.9E-161873IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.601.4E-181973IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 371 aa     Download sequence    Send to blast
MIEVFDSGFM EDKGFVEQKR RLKTPSQVEA LENIYAEHKY PTESMKAKLS RELGLSEKQV  60
QRWFRHRRLK DKKGKKEDPD SNEELDAGSG SNLQQQQHVV RTELGRSEKR RLLGTSDYPS  120
AVLAAELTDH DMLKRNHGVM EEDPHHAGNV STSQDTSSLQ SRSSYEMEAL RNGNYVEMKG  180
SNTKKRKGQV MHMGMEHTYP QHFAAATEEQ YTARGLKQTG GSNSKQAKNW NHFKAKEGEN  240
HRFLNNHDYP SAVLAAELTD RELLKGNHDI VEDPYVSLSQ ERSSLQSGSS YEMEARRLPS  300
KSLNSFEIEA RSKRREKEGL HMGVEPLYWQ HAVEHRAISG VKSQLGRLFQ EDGPMLGVEF  360
DPLPPDAFGY R
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT1235580.0BT123558.1 Picea sitchensis clone WS04714_L06 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLD5ABF40.0D5ABF4_PICSI; Uncharacterized protein
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G03250.16e-21HB-other family protein