PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PSME_00045276-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Pseudotsuga
Family VOZ
Protein Properties Length: 329aa    MW: 37071.8 Da    PI: 5.121
Description VOZ family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PSME_00045276-RAgenomePRSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1VOZ4135.6e-1271063221217
               VOZ   1 pppsaflgpkcalwdctrpaqgsewlqdycssfhatlalneglpgttpvlrpkgidlkdgllfaalsakvqgkevgipecegaatakspwnaa 93 
                       ppp+aflgpkcalwdc+rpaqg++w+qdycs fh tla neg+p ++pvlrp+gidlkdg+lfaalsak+q k vgipecegaatakspwna 
  PSME_00045276-RA 106 PPPAAFLGPKCALWDCSRPAQGTKWCQDYCSDFHMTLASNEGAPRMRPVLRPGGIDLKDGPLFAALSAKTQEKAVGIPECEGAATAKSPWNAY 198
                       89******************************************************************************************* PP

               VOZ  94 elfdlsllegetirewlffdkprrafesgnrkqrslpdysgrgwhesrkqvmkefgglkrsyymdpqpsssfewhlyeyeineldalalyrle 186
                       elfd+ +lege++rewlffdkp+rafesgnrkqrslpdysgrgwhesrkqv+k+fgglkrsyymdpqps++fewh+yeyein +da+alyrle
  PSME_00045276-RA 199 ELFDMYVLEGESMREWLFFDKPQRAFESGNRKQRSLPDYSGRGWHESRKQVIKDFGGLKRSYYMDPQPSTQFEWHIYEYEINYCDACALYRLE 291
                       ********************************************************************************************* PP

               VOZ 187 lklvdekksakgkvskdsladlqkklgrlta 217
                       lk+v +kk++kgkv  d+l+dlq++lg+l+a
  PSME_00045276-RA 292 LKMVYSKKNTKGKVGGDPLVDLQHQLGKLSA 322
                       *****************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:3.30.70.3306.6E-4249IPR012677Nucleotide-binding alpha-beta plait domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000166Molecular Functionnucleotide binding
Sequence ? help Back to Top
Protein Sequence    Length: 329 aa     Download sequence    Send to blast
MTYVDYHMGA ESGYVHFEQP KMVQKPRAAA VLAEEGGNSY PQTSVQLPAN IEHQENNNYV  60
QTSEQLPPNL VEGLEDYIPD AQPIFTLTSE EETSPVFNGP QPGLCPPPAA FLGPKCALWD  120
CSRPAQGTKW CQDYCSDFHM TLASNEGAPR MRPVLRPGGI DLKDGPLFAA LSAKTQEKAV  180
GIPECEGAAT AKSPWNAYEL FDMYVLEGES MREWLFFDKP QRAFESGNRK QRSLPDYSGR  240
GWHESRKQVI KDFGGLKRSY YMDPQPSTQF EWHIYEYEIN YCDACALYRL ELKMVYSKKN  300
TKGKVGGDPL VDLQHQLGKL SAEFSWVAK
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator acting positively in the phytochrome B signaling pathway. Functions redundantly with VOZ2 to promote flowering downstream of phytochrome B (phyB). Down-regulates 'FLOWERING LOCUS C' (FLC) and up-regulates 'FLOWERING LOCUS T' (FT). Binds to the 38-bp cis-acting region of the AVP1 gene. Interacts with phyB in the cytoplasm and is translocated to the nucleus at signal transmission, where it is subjected to degradation in a phytochrome-dependent manner. {ECO:0000269|PubMed:15295067, ECO:0000269|PubMed:22904146}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By far-red light. {ECO:0000269|PubMed:22904146}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010657013.11e-133PREDICTED: transcription factor VOZ1
RefseqXP_019079230.11e-133PREDICTED: transcription factor VOZ1
SwissprotQ9SGQ01e-125VOZ1_ARATH; Transcription factor VOZ1
TrEMBLA5CA221e-131A5CA22_VITVI; Uncharacterized protein
TrEMBLF6H4X21e-131F6H4X2_VITVI; Uncharacterized protein
STRINGVIT_12s0028g02670.t011e-132(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G28520.21e-127vascular plant one zinc finger protein
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  2. Yasui Y,Kohchi T
    VASCULAR PLANT ONE-ZINC FINGER1 and VOZ2 repress the FLOWERING LOCUS C clade members to control flowering time in Arabidopsis.
    Biosci. Biotechnol. Biochem., 2014. 78(11): p. 1850-5
    [PMID:25351333]
  3. Kumar S,Choudhary P,Gupta M,Nath U
    VASCULAR PLANT ONE-ZINC FINGER1 (VOZ1) and VOZ2 Interact with CONSTANS and Promote Photoperiodic Flowering Transition.
    Plant Physiol., 2018. 176(4): p. 2917-2930
    [PMID:29507119]
  4. Song C,Lee J,Kim T,Hong JC,Lim CO
    VOZ1, a transcriptional repressor of DREB2C, mediates heat stress responses in Arabidopsis.
    Planta, 2018. 247(6): p. 1439-1448
    [PMID:29536220]