PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PSME_00044170-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Pseudotsuga
Family M-type_MADS
Protein Properties Length: 371aa    MW: 40676.8 Da    PI: 9.2202
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PSME_00044170-RAgenomePRSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF79.91.7e-25235284150
                       S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS
            SRF-TF   1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50 
                       krien + rqvtfskR n +lKKA+ELSvLCdaev ++ fs++gklye++
  PSME_00044170-RA 235 KRIENATSRQVTFSKRSNELLKKAYELSVLCDAEVGLMTFSPRGKLYEFA 284
                       79***********************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF554554.97E-24227289IPR002100Transcription factor, MADS-box
SMARTSM004323.5E-33227286IPR002100Transcription factor, MADS-box
PROSITE profilePS5006628.287227287IPR002100Transcription factor, MADS-box
CDDcd002652.58E-33229286No hitNo description
PRINTSPR004047.6E-26229249IPR002100Transcription factor, MADS-box
PfamPF003192.8E-23236283IPR002100Transcription factor, MADS-box
PRINTSPR004047.6E-26249264IPR002100Transcription factor, MADS-box
PRINTSPR004047.6E-26264285IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 371 aa     Download sequence    Send to blast
NTPPPKPWEH VGSSSGPSPF RPSSTRPTIT VVESSGNSDT ERNVPLANIS TVGRPMPARP  60
WEQGSYGSNY GGYGSTTNYN SGYGSMTNYN LGYGLAGSYG GGLYGNNMYR GGYGGSNGFG  120
GMYNNGIGGP MGGYGMGPGG PYDNGNGDPN DPFGGPPSPP SFWQSMLLVG LYFPFLLELD  180
GTKEQIKQSP SSEHLIVSQR CMLRSLDISP NNGCMGALKL KRMGRRMVRG KTLMKRIENA  240
TSRQVTFSKR SNELLKKAYE LSVLCDAEVG LMTFSPRGKL YEFANPRHVL NRNASSLEVD  300
DSEKLVIENR LGCDLYIRQY RDNFEDIKLL KPDSNVHVHL PPPRFPDRLN AVIETKDSRY  360
YVAVHILDAR V
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT1152271e-79BT115227.1 Picea glauca clone GQ03611_N11 mRNA sequence.
GenBankEF0871621e-79EF087162.1 Picea sitchensis clone WS02913_M21 unknown mRNA.
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G45660.17e-28AGAMOUS-like 20