PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PSME_00044047-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Pseudotsuga
Family VOZ
Protein Properties Length: 482aa    MW: 53801.7 Da    PI: 5.8299
Description VOZ family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PSME_00044047-RAgenomePRSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1VOZ398.51.5e-1222594751217
               VOZ   1 pppsaflgpkcalwdctrpaqgsewlqdycssfhatlalneglpgttpvlrpkgidlkdgllfaalsakvqgkevgipecegaatakspwnaa 93 
                       ppp+aflgpkcalwdc+rpaqg++w+qdycs fh tla neg+p ++pvl p+gidlkdg+lfaalsak+q k vgipecegaatakspwna 
  PSME_00044047-RA 259 PPPAAFLGPKCALWDCSRPAQGTKWCQDYCSDFHMTLASNEGAPKMRPVLCPGGIDLKDGPLFAALSAKTQEKAVGIPECEGAATAKSPWNAY 351
                       89******************************************************************************************* PP

               VOZ  94 elfdlsllegetirewlffdkprrafesgnrkqrslpdysgrgwhesrkqvmkefgglkrsyymdpqpsssfewhlyeyeineldalalyrle 186
                       elfd+ +lege++rew+ffdkprr fesgnrkq slpdysgrgwhesrkqv+k+fgglkrsyymdp ps++fewh+yeyein++da+alyrle
  PSME_00044047-RA 352 ELFDMYVLEGESMREWIFFDKPRRDFESGNRKQCSLPDYSGRGWHESRKQVIKDFGGLKRSYYMDPHPSTQFEWHIYEYEINDCDACALYRLE 444
                       ********************************************************************************************* PP

               VOZ 187 lklvdekksakgkvskdsladlqkklgrlta 217
                       l +v +kk++kgkv  d+l+dlq++lg+l+a
  PSME_00044047-RA 445 LNMVCSKKNTKGKVGGDPLVDLQHQLGKLSA 475
                       *****************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:3.30.70.3302.1E-786134IPR012677Nucleotide-binding alpha-beta plait domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000166Molecular Functionnucleotide binding
Sequence ? help Back to Top
Protein Sequence    Length: 482 aa     Download sequence    Send to blast
GAFQHTAGQS SAYSSSFLLR RVQTDSSRGF FLTIRSQEEE GEQYQIGRVF KSFREMAGEK  60
PKTGNVWNTV KPFVNGGASG MLPTCVIQPV DMIKYVDYHM GAESGYVRFE QPEMVQKPRA  120
AAVLAEEGGV KLRRNTGLSS VKVKISVGNL QATDFLVDDL HTPEKDFERI SRCTIIGEGL  180
HQNSYPQTSV QLPANIEHQE NNNYVQTSEQ LPPNLVEGLE VTSGLEGGRI NFHQDYIPTA  240
QPIFTLTGEE ETSPPGLCPP PAAFLGPKCA LWDCSRPAQG TKWCQDYCSD FHMTLASNEG  300
APKMRPVLCP GGIDLKDGPL FAALSAKTQE KAVGIPECEG AATAKSPWNA YELFDMYVLE  360
GESMREWIFF DKPRRDFESG NRKQCSLPDY SGRGWHESRK QVIKDFGGLK RSYYMDPHPS  420
TQFEWHIYEY EINDCDACAL YRLELNMVCS KKNTKGKVGG DPLVDLQHQL GKLSAEFSWV  480
AK
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT1185311e-80BT118531.1 Picea glauca clone GQ04007_G03 mRNA sequence.
GenBankEF6772861e-80EF677286.1 Picea sitchensis clone WS02764_M18 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010260370.11e-128PREDICTED: transcription factor VOZ1
TrEMBLA0A1U8A0G41e-127A0A1U8A0G4_NELNU; transcription factor VOZ1
STRINGXP_010260370.11e-128(Nelumbo nucifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G28520.21e-121vascular plant one zinc finger protein