PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PSME_00043819-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Pseudotsuga
Family M-type_MADS
Protein Properties Length: 559aa    MW: 63326.7 Da    PI: 9.6245
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PSME_00043819-RAgenomePRSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF49.17.3e-165352050
                      HHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS
            SRF-TF 20 ilKKAeELSvLCdaevaviifsstgklyeys 50
                      +lKKA+ELSvLCda+v ++ifs++gklye++
  PSME_00043819-RA  5 LLKKAYELSVLCDAKVGLMIFSPRGKLYEFA 35
                      9*****************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006616.638138IPR002100Transcription factor, MADS-box
SMARTSM004322.0E-7237IPR002100Transcription factor, MADS-box
PfamPF003191.1E-12334IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.7E-13349IPR002100Transcription factor, MADS-box
PfamPF031699.8E-11338541IPR004813Oligopeptide transporter, OPT superfamily
TIGRFAMsTIGR007281.5E-12156542IPR004813Oligopeptide transporter, OPT superfamily
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0055085Biological Processtransmembrane transport
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 559 aa     Download sequence    Send to blast
MMNRLLKKAY ELSVLCDAKV GLMIFSPRGK LYEFANPRTL HEREQRKGLS RMQFFTISAI  60
ISFSYYVLRG YLFTILSFFS WICRINPDSV TANQTGSGLH GLGIWAVTLD WAGVSSYIGS  120
PLVTPWFSIV NIGIGFFLFI YVFIPLSYWK FDIYNAKRFP IFSSQLFTDA GQKYNTTQIL  180
TPEFGLNIDA YNNYSKLYLS TFFAFSTGFG FARIAATLTH VILFNGKSSI NTKKPNIHAR  240
LMKNYNDVPQ WWFLILLVGS MALSLILSII WKDDIQLPWW GMLLACGLAC ILILPIGVVQ  300
ATTNQQAGYN VVAEFIIGYI LPGKPIANIL FKTYGRISTV HALYFLADLK LGHHMKIPPR  360
CMYTAQWLTC ECTQLVGTIV AGTINLCIAW WMLTGIENIC DVDSLPPDSP WTCLKDRVAF  420
DASVIWGLVG PKHLFGPLGP YKSLVWFFLV GALLPGIVWI LSKLFPKAEW LKLINILVLL  480
GGFSSMPPAT PVNIGTWIII GTIFNYFIFR LWRGWWQRYN YVLSASMDAG TTFMGVLIYF  540
SFGSEKKGLK WWGTKIDHP
Functional Description ? help Back to Top
Source Description
UniProtMay be involved in the translocation of tetra- and pentapeptides across the cellular membrane in an energy-dependent manner. Acts also as a metal transporter that could be a component of the copper transport machinery. Essential for early embryo development. {ECO:0000269|PubMed:11788749, ECO:0000269|PubMed:12417702, ECO:0000269|PubMed:13129917}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Highly induced by iron, copper and manganese deficiencies. {ECO:0000269|PubMed:13129917}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFJ0605101e-116FJ060510.2 Pinus taeda isolate 1581 anonymous locus 0_16808_01 genomic sequence.
GenBankFJ0605131e-116FJ060513.2 Pinus taeda isolate 1592 anonymous locus 0_16808_01 genomic sequence.
GenBankFJ0605141e-116FJ060514.2 Pinus taeda isolate 1598 anonymous locus 0_16808_01 genomic sequence.
GenBankFJ0605151e-116FJ060515.2 Pinus taeda isolate 1584 anonymous locus 0_16808_01 genomic sequence.
GenBankFJ0605171e-116FJ060517.2 Pinus taeda isolate 1596 anonymous locus 0_16808_01 genomic sequence.
GenBankFJ0605201e-116FJ060520.2 Pinus taeda isolate 1587 anonymous locus 0_16808_01 genomic sequence.
GenBankFJ0605211e-116FJ060521.2 Pinus taeda isolate 1590 anonymous locus 0_16808_01 genomic sequence.
GenBankFJ0605221e-116FJ060522.2 Pinus taeda isolate 1589 anonymous locus 0_16808_01 genomic sequence.
GenBankFJ0605251e-116FJ060525.2 Pinus taeda isolate 1582 anonymous locus 0_16808_01 genomic sequence.
GenBankJQ2621631e-116JQ262163.1 Pinus radiata isolate 13474 hypothetical protein (0_16808_01) gene, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006856263.10.0oligopeptide transporter 3
SwissprotO234820.0OPT3_ARATH; Oligopeptide transporter 3
TrEMBLU5D6640.0U5D664_AMBTC; Uncharacterized protein
STRINGERN177300.0(Amborella trichopoda)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G11880.16e-12AGAMOUS-like 14
Publications ? help Back to Top
  1. Koh S, et al.
    An oligopeptide transporter gene family in Arabidopsis.
    Plant Physiol., 2002. 128(1): p. 21-9
    [PMID:11788749]
  2. Stacey MG,Koh S,Becker J,Stacey G
    AtOPT3, a member of the oligopeptide transporter family, is essential for embryo development in Arabidopsis.
    Plant Cell, 2002. 14(11): p. 2799-811
    [PMID:12417702]
  3. Wintz H, et al.
    Expression profiles of Arabidopsis thaliana in mineral deficiencies reveal novel transporters involved in metal homeostasis.
    J. Biol. Chem., 2003. 278(48): p. 47644-53
    [PMID:13129917]
  4. Stacey MG,Osawa H,Patel A,Gassmann W,Stacey G
    Expression analyses of Arabidopsis oligopeptide transporters during seed germination, vegetative growth and reproduction.
    Planta, 2006. 223(2): p. 291-305
    [PMID:16151844]
  5. Sugiura M,Georgescu MN,Takahashi M
    A nitrite transporter associated with nitrite uptake by higher plant chloroplasts.
    Plant Cell Physiol., 2007. 48(7): p. 1022-35
    [PMID:17566055]
  6. Stacey MG, et al.
    The Arabidopsis AtOPT3 protein functions in metal homeostasis and movement of iron to developing seeds.
    Plant Physiol., 2008. 146(2): p. 589-601
    [PMID:18083798]
  7. Zhai Z, et al.
    OPT3 Is a Phloem-Specific Iron Transporter That Is Essential for Systemic Iron Signaling and Redistribution of Iron and Cadmium in Arabidopsis.
    Plant Cell, 2014. 26(5): p. 2249-2264
    [PMID:24867923]
  8. Mendoza-Cózatl DG, et al.
    OPT3 is a component of the iron-signaling network between leaves and roots and misregulation of OPT3 leads to an over-accumulation of cadmium in seeds.
    Mol Plant, 2014. 7(9): p. 1455-1469
    [PMID:24880337]
  9. Khan MA, et al.
    Changes in iron availability in Arabidopsis are rapidly sensed in the leaf vasculature and impaired sensing leads to opposite transcriptional programs in leaves and roots.
    Plant Cell Environ., 2018. 41(10): p. 2263-2276
    [PMID:29520929]
  10. Steiner HY, et al.
    An Arabidopsis peptide transporter is a member of a new class of membrane transport proteins.
    Plant Cell, 1994. 6(9): p. 1289-99
    [PMID:7919993]
  11. Rentsch D,Hirner B,Schmelzer E,Frommer WB
    Salt stress-induced proline transporters and salt stress-repressed broad specificity amino acid permeases identified by suppression of a yeast amino acid permease-targeting mutant.
    Plant Cell, 1996. 8(8): p. 1437-46
    [PMID:8776904]