PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PSME_00043428-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Pseudotsuga
Family HB-other
Protein Properties Length: 216aa    MW: 24369.9 Da    PI: 6.2827
Description HB-other family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PSME_00043428-RAgenomePRSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox14.75.3e-05761061646
                       HHHHHHSSS--HHHHHHHHHHCTS-HHHHHH CS
          Homeobox  16 eelFeknrypsaeereeLAkklgLterqVkv 46 
                       +e+F+++++++ +++   +++l+L  rqV v
  PSME_00043428-RA  76 KEYFNEHNTLNSKQKLAFTEQLNLRPRQVEV 106
                       6899*************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.606.0E-472107IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 216 aa     Download sequence    Send to blast
MKELAGRNNL HERGWPAAFH SMDFAICNGT CAVKRERDDD HPDNNANDHE LDRACSRASD  60
EEEDGRTSRK KLHLSKEYFN EHNTLNSKQK LAFTEQLNLR PRQVEVYGSI TEEPNEADRS  120
GLLISEEMPQ NPYRREQVTA ERYSIAEGFE SGASKILHAL ACNHSLNMCP SYDRIASASL  180
PLDNNTKGLH GHGPSPWPTL ASAHLRTTQP PPRLEQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA9NV751e-46A9NV75_PICSI; Uncharacterized protein
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G47370.16e-14Homeobox-leucine zipper protein 4 (HB-4) / HD-ZIP protein