PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PSME_00043380-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Pseudotsuga
Family TALE
Protein Properties Length: 964aa    MW: 106106 Da    PI: 6.1797
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PSME_00043380-RAgenomePRSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox28.62.4e-096647011954
                       HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
          Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                       Fe   ++yp+ +++  LAk++gLt +qV++WF N R +
  PSME_00043380-RA 664 FEHflHPYPTDADKHILAKQTGLTRSQVSNWFINARVR 701
                       554459******************************88 PP

2BELL113.71e-36526596272
              BELL   2 rqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                       r elq++kakL+s+l+eVd+rY+ y++q+q v+ssFe +  lg+a+pYt+lAlka+SrhFrcLkda+++q+
  PSME_00043380-RA 526 RFELQRRKAKLVSMLDEVDRRYRNYCDQMQLVVSSFESASTLGAAAPYTALALKAMSRHFRCLKDAVTGQL 596
                       779*****************************************************************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005741.0E-52451594IPR006563POX domain
PfamPF075261.2E-46457593IPR006563POX domain
PROSITE profilePS5007112.39642705IPR001356Homeobox domain
SMARTSM003895.6E-10645709IPR001356Homeobox domain
CDDcd000865.51E-13645706No hitNo description
SuperFamilySSF466894.28E-17646711IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.2E-28648711IPR009057Homeodomain-like
PfamPF059203.8E-18662701IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009965Biological Processleaf morphogenesis
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 964 aa     Download sequence    Send to blast
GEIHESLLLV DEDEEGSNGS VQSWGLRLSR LLLGVEAGKA FEFSCQQTAA AADWQIYIAD  60
GVAVELLEWT IKPVFIRLEL TYFLLGFLGV SRGIELLAFS SKNQFLDHNS EAEASSRSSV  120
IGTSYQGLGN PGGNLGNWKS FNVPQNRSNT VWAAPSIVVP NNMQQQQQHH HGGLVYNSGQ  180
VIPNPIVVAR GGSMQVGSSG DIRKGDMEVA SQNPHHQTDH GTHLFLMNPK YPNEFPEGTS  240
TAAANMTEIR PTNGLNPPGF EAQKNILEFP HFPTQIPTII SEASPSLRDP SHGTGSDLPG  300
SGNMQHSQLM LAQFNNTLNW ANRYSGSQPW NREQFIENKV DESFRSEYSS KGQDGSGQRL  360
SLSLSSHQPS EMHLQDIANQ TNVLQFGGDA KSKLGDLFNS AHGTTTDGLA YNISSYSRNG  420
IPGKGFMDSI QGGGRSAILQ YMKDGSTGAF AGYGLGLKNS RYLKAAQEIL YEFCNVGRGI  480
ETKTSPKQKL SMEVNVIPGS SSSRSHEFGA KTETGMMNQP FYPGDRFELQ RRKAKLVSML  540
DEVDRRYRNY CDQMQLVVSS FESASTLGAA APYTALALKA MSRHFRCLKD AVTGQLQVTI  600
KALGEKGSVV PGTSRGETPR LGFLERSIRQ QRAFHHLGLM EQHPWRPQRG LPERSVSVLR  660
AWLFEHFLHP YPTDADKHIL AKQTGLTRSQ VSNWFINARV RLWKPMVEEM YIEETKEEKV  720
DQVGQNAEAE AERSTGTNND ENTMFNSGGA DNKCTANSEE AAFKLDHSSS TTSQTGQADI  780
ISSGNVTLHL QSKDPEMAVA RETSESLSSM NTSHEGDMKL DAAPGYNIFE QDKGFRNELY  840
ASKFQTAGHT GMSVDFSSYN NTTTSTTVAA YSHGDLTPRQ FANSGVSLTL GLRHSGGLSY  900
NPLNEQKYDN NIYFSRVQDD ADPGSQYSML DNEVSPGNGF MQEQDIEYRN YIVNGSRLLH  960
DFVG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4xrs_A2e-16651708158Homeobox protein Meis1
4xrs_B2e-16651708158Homeobox protein Meis1
5bng_A3e-16651709159Homeobox protein Meis2
5bng_B3e-16651709159Homeobox protein Meis2
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT1033970.0BT103397.1 Picea glauca clone GQ02512_F23 mRNA sequence.
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G23760.33e-90BEL1-like homeodomain 4