PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PSME_00042612-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Pseudotsuga
Family HB-other
Protein Properties Length: 182aa    MW: 20981.6 Da    PI: 10.7003
Description HB-other family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PSME_00042612-RAgenomePRSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox16.91.1e-0563106952
                       HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHH CS
          Homeobox   9 keqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrR 52 
                       ++ +e+  ++F +n  ps   +  L+k+l+L+ + V +W +N R
  PSME_00042612-RA  63 ANAVERFRQVFFENELPSMPYKLVLSKQLDLPYQHVHMWLKNAR 106
                       5678889999********************************99 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.604.0E-844106IPR009057Homeodomain-like
PROSITE profilePS5007110.34952112IPR001356Homeobox domain
SMARTSM003890.003454116IPR001356Homeobox domain
SuperFamilySSF466892.78E-754115IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 182 aa     Download sequence    Send to blast
MPRNEKSNET NIMGKGVVGP KKKIPKEKEV ESASLTSVVR VENKSRNTKR KNESRRTLSR  60
LPANAVERFR QVFFENELPS MPYKLVLSKQ LDLPYQHVHM WLKNARHMSL KKKKLNCLKE  120
SVAPVIFANT IRLKVEIYPK EGVDFSNDKN PEGISNLLSE ELLMYVPVVE LRKKTLQVAP  180
VK
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G29940.14e-14pathogenesis related homeodomain protein A